BLASTX nr result
ID: Zingiber23_contig00003577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00003577 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD42941.1|AF091621_1 ubiquitin-conjugating enzyme E2 [Cathar... 80 4e-13 ref|XP_006591826.1| PREDICTED: uncharacterized protein LOC100306... 78 1e-12 ref|XP_006591825.1| PREDICTED: uncharacterized protein LOC100306... 78 1e-12 ref|XP_006580942.1| PREDICTED: uncharacterized protein LOC100500... 78 1e-12 ref|XP_006389951.1| hypothetical protein EUTSA_v10019278mg [Eutr... 78 1e-12 ref|XP_006302954.1| hypothetical protein CARUB_v10021093mg [Caps... 78 1e-12 ref|NP_001241639.1| uncharacterized protein LOC100805631 [Glycin... 78 1e-12 ref|NP_849678.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis... 78 1e-12 ref|NP_564011.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis... 78 1e-12 gb|AFK36542.1| unknown [Lotus japonicus] 78 1e-12 ref|XP_003633254.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 78 1e-12 ref|NP_001185017.1| ubiquitin-conjugating enzyme E2 36 [Arabidop... 78 1e-12 dbj|BAJ93925.1| predicted protein [Hordeum vulgare subsp. vulgar... 78 1e-12 ref|NP_001235055.1| uncharacterized protein LOC100500231 [Glycin... 78 1e-12 ref|NP_001235245.1| uncharacterized protein LOC100306707 [Glycin... 78 1e-12 ref|XP_002280492.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 78 1e-12 gb|ABI84266.1| ubiquitin-conjugating enzyme 1 like protein [Arac... 78 1e-12 ref|XP_003567909.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 78 1e-12 ref|XP_006442524.1| hypothetical protein CICLE_v10022662mg [Citr... 77 2e-12 ref|XP_006442523.1| hypothetical protein CICLE_v10022662mg [Citr... 77 2e-12 >gb|AAD42941.1|AF091621_1 ubiquitin-conjugating enzyme E2 [Catharanthus roseus] Length = 153 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYAT A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYATGA 153 >ref|XP_006591826.1| PREDICTED: uncharacterized protein LOC100306707 isoform X2 [Glycine max] Length = 120 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 83 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 120 >ref|XP_006591825.1| PREDICTED: uncharacterized protein LOC100306707 isoform X1 [Glycine max] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 153 >ref|XP_006580942.1| PREDICTED: uncharacterized protein LOC100500231 isoform X1 [Glycine max] Length = 120 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 83 APNPDDPLSENIAKHWKSNEAEAVETAKEWTQLYASGA 120 >ref|XP_006389951.1| hypothetical protein EUTSA_v10019278mg [Eutrema salsugineum] gi|557086385|gb|ESQ27237.1| hypothetical protein EUTSA_v10019278mg [Eutrema salsugineum] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 153 >ref|XP_006302954.1| hypothetical protein CARUB_v10021093mg [Capsella rubella] gi|482571664|gb|EOA35852.1| hypothetical protein CARUB_v10021093mg [Capsella rubella] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 153 >ref|NP_001241639.1| uncharacterized protein LOC100805631 [Glycine max] gi|297839753|ref|XP_002887758.1| ubiquitin-conjugating enzyme 1 [Arabidopsis lyrata subsp. lyrata] gi|71040675|gb|AAZ20286.1| ubiquitin-conjugating enzyme 1 [Arachis hypogaea] gi|217075352|gb|ACJ86036.1| unknown [Medicago truncatula] gi|255628881|gb|ACU14785.1| unknown [Glycine max] gi|255641415|gb|ACU20984.1| unknown [Glycine max] gi|297333599|gb|EFH64017.1| ubiquitin-conjugating enzyme 1 [Arabidopsis lyrata subsp. lyrata] gi|378464294|gb|AFC01194.1| ubiquitin-conjugating enzyme [Ammopiptanthus mongolicus] gi|388491284|gb|AFK33708.1| unknown [Medicago truncatula] gi|557880983|gb|AHA42249.1| Fen-interacting protein 3 [Nicotiana benthamiana] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 153 >ref|NP_849678.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] gi|332191394|gb|AEE29515.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] Length = 120 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 83 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 120 >ref|NP_564011.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] gi|567757547|ref|NP_001274716.1| ubiquitin-conjugating enzyme E2 36-like [Solanum lycopersicum] gi|225446595|ref|XP_002280480.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform 1 [Vitis vinifera] gi|297850090|ref|XP_002892926.1| hypothetical protein ARALYDRAFT_889082 [Arabidopsis lyrata subsp. lyrata] gi|565491510|ref|XP_006303394.1| hypothetical protein CARUB_v10010547mg [Capsella rubella] gi|75334547|sp|Q9FZ48.1|UBC36_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 36; AltName: Full=Ubiquitin carrier protein 36 gi|9802775|gb|AAF99844.1|AC051629_11 Putative ubiquitin-conjugating enzyme E2 [Arabidopsis thaliana] gi|15450413|gb|AAK96500.1| At1g16890/F17F16.16 [Arabidopsis thaliana] gi|16974499|gb|AAL31253.1| At1g16890/F17F16.16 [Arabidopsis thaliana] gi|21555312|gb|AAM63831.1| E2, ubiquitin-conjugating enzyme, putative [Arabidopsis thaliana] gi|66354480|gb|AAY44875.1| ubiquitinating enzyme [Arabidopsis thaliana] gi|297338768|gb|EFH69185.1| hypothetical protein ARALYDRAFT_889082 [Arabidopsis lyrata subsp. lyrata] gi|302143419|emb|CBI21980.3| unnamed protein product [Vitis vinifera] gi|332191395|gb|AEE29516.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] gi|482572105|gb|EOA36292.1| hypothetical protein CARUB_v10010547mg [Capsella rubella] gi|557880985|gb|AHA42250.1| Ubc13-type ubiquitin-conjugating enzyme 2 [Solanum lycopersicum] gi|557880987|gb|AHA42251.1| Ubc13-type ubiquitin-conjugating enzyme 2 [Nicotiana benthamiana] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 153 >gb|AFK36542.1| unknown [Lotus japonicus] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 153 >ref|XP_003633254.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Vitis vinifera] Length = 163 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 126 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 163 >ref|NP_001185017.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] gi|332191396|gb|AEE29517.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] Length = 162 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 125 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 162 >dbj|BAJ93925.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326527453|dbj|BAK08001.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 153 >ref|NP_001235055.1| uncharacterized protein LOC100500231 [Glycine max] gi|255629772|gb|ACU15235.1| unknown [Glycine max] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTQLYASGA 153 >ref|NP_001235245.1| uncharacterized protein LOC100306707 [Glycine max] gi|255629335|gb|ACU15012.1| unknown [Glycine max] Length = 133 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 96 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 133 >ref|XP_002280492.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform 2 [Vitis vinifera] Length = 154 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 117 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 154 >gb|ABI84266.1| ubiquitin-conjugating enzyme 1 like protein [Arachis hypogaea] Length = 153 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 153 >ref|XP_003567909.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Brachypodium distachyon] Length = 153 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSEN+AKHWKSNEAEAVETAKEWT LYA+ A Sbjct: 116 APNPDDPLSENVAKHWKSNEAEAVETAKEWTRLYASGA 153 >ref|XP_006442524.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544786|gb|ESR55764.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] Length = 120 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWK+NEAEAVETAKEWT LYA+ A Sbjct: 83 APNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 120 >ref|XP_006442523.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544785|gb|ESR55763.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] Length = 151 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 3 APNPDDPLSENIAKHWKSNEAEAVETAKEWTHLYATSA 116 APNPDDPLSENIAKHWK+NEAEAVETAKEWT LYA+ A Sbjct: 114 APNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 151