BLASTX nr result
ID: Zingiber23_contig00003382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00003382 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836429.1| hypothetical protein AMTR_s00092p00162140 [A... 56 6e-06 >ref|XP_006836429.1| hypothetical protein AMTR_s00092p00162140 [Amborella trichopoda] gi|548838947|gb|ERM99282.1| hypothetical protein AMTR_s00092p00162140 [Amborella trichopoda] Length = 141 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -1 Query: 354 PSGDVYVGGSTGLLIWAVTXXXXXXXXXXLVYNTSALSQ 238 PSGDVYVGGSTGLLIWAVT LVYNTSALSQ Sbjct: 103 PSGDVYVGGSTGLLIWAVTLAGVLAGGALLVYNTSALSQ 141