BLASTX nr result
ID: Zingiber23_contig00003218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00003218 (496 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165590.1| PREDICTED: translation machinery-associated ... 58 1e-06 >ref|XP_004165590.1| PREDICTED: translation machinery-associated protein 7-like [Cucumis sativus] Length = 109 Score = 57.8 bits (138), Expect = 1e-06 Identities = 37/95 (38%), Positives = 47/95 (49%), Gaps = 4/95 (4%) Frame = -3 Query: 485 GLHSIHSPATIIITQKPPLY----LPCLCLSVLFPSRQTQAIMSSKQGGKLKPLKQPKSE 318 GL SI+ + ++I +KP + +P L L P+ + MSSKQGGK KPLKQPK + Sbjct: 4 GLASINRFSPVVILEKPSIVANRVIPLCVLLRLGPNPSDISAMSSKQGGKAKPLKQPKVD 63 Query: 317 KKAYDEADXXXXXXXXXXXXXXXXXXXXASQKGAF 213 KK YDE D A QKG F Sbjct: 64 KKDYDEVDMANMQKKKDEEKALKELRAKAQQKGTF 98