BLASTX nr result
ID: Zingiber23_contig00002659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00002659 (232 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADK70390.1| rubisco activase [Musa AB Group] 82 7e-14 ref|XP_003616450.1| Ribulose-1 5-bisphosphate carboxylase/oxygen... 81 1e-13 gb|ESW06054.1| hypothetical protein PHAVU_010G016000g [Phaseolus... 80 3e-13 gb|AGZ15382.1| ribulose bisphosphate carboxylase/oxygenase activ... 80 3e-13 ref|XP_004307478.1| PREDICTED: ribulose bisphosphate carboxylase... 80 4e-13 ref|NP_001240152.1| ribulose bisphosphate carboxylase/oxygenase ... 80 4e-13 gb|ESW13396.1| hypothetical protein PHAVU_008G192400g [Phaseolus... 79 5e-13 ref|XP_004490873.1| PREDICTED: ribulose bisphosphate carboxylase... 79 5e-13 ref|XP_004302722.1| PREDICTED: ribulose bisphosphate carboxylase... 79 5e-13 ref|XP_002270571.2| PREDICTED: ribulose bisphosphate carboxylase... 79 5e-13 ref|NP_001242531.1| ribulose bisphosphate carboxylase/oxygenase ... 79 6e-13 ref|XP_006435642.1| hypothetical protein CICLE_v10031443mg [Citr... 79 8e-13 ref|XP_006435641.1| hypothetical protein CICLE_v10031443mg [Citr... 79 8e-13 ref|XP_006435638.1| hypothetical protein CICLE_v10031443mg [Citr... 79 8e-13 ref|XP_006435637.1| hypothetical protein CICLE_v10031443mg [Citr... 79 8e-13 ref|XP_002532996.1| Ribulose bisphosphate carboxylase/oxygenase ... 79 8e-13 ref|XP_006411205.1| hypothetical protein EUTSA_v10016600mg [Eutr... 78 1e-12 gb|EMJ22189.1| hypothetical protein PRUPE_ppa005158mg [Prunus pe... 78 1e-12 ref|XP_002971784.1| hypothetical protein SELMODRAFT_95817 [Selag... 78 1e-12 ref|XP_002524206.1| Ribulose bisphosphate carboxylase/oxygenase ... 78 1e-12 >gb|ADK70390.1| rubisco activase [Musa AB Group] Length = 68 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 EFYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLY 119 +FYGKAAQQV+IPVPEGCTDPIA NFDPTARSDDGSCLY Sbjct: 30 QFYGKAAQQVNIPVPEGCTDPIATNFDPTARSDDGSCLY 68 >ref|XP_003616450.1| Ribulose-1 5-bisphosphate carboxylase/oxygenase activase [Medicago truncatula] gi|355517785|gb|AES99408.1| Ribulose-1 5-bisphosphate carboxylase/oxygenase activase [Medicago truncatula] Length = 476 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYT 122 FYGKAAQQV+IP+PEGCTDP AKNFDPTARSDDG+CLYT Sbjct: 436 FYGKAAQQVNIPIPEGCTDPNAKNFDPTARSDDGTCLYT 474 >gb|ESW06054.1| hypothetical protein PHAVU_010G016000g [Phaseolus vulgaris] Length = 474 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYTV 125 FYG+AAQQVH+PVPEGCTDP A+N+DPTARSDDGSC YT+ Sbjct: 435 FYGQAAQQVHVPVPEGCTDPAAENYDPTARSDDGSCTYTL 474 >gb|AGZ15382.1| ribulose bisphosphate carboxylase/oxygenase activase 1 [Phaseolus vulgaris] Length = 474 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYTV 125 FYG+AAQQVH+PVPEGCTDP A+N+DPTARSDDGSC YT+ Sbjct: 435 FYGQAAQQVHVPVPEGCTDPTAENYDPTARSDDGSCTYTL 474 >ref|XP_004307478.1| PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 477 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYT 122 FYGKAAQQV +PVPEGCTDP A NFDPTARSDDG+CLYT Sbjct: 438 FYGKAAQQVRVPVPEGCTDPTANNFDPTARSDDGTCLYT 476 >ref|NP_001240152.1| ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic-like [Glycine max] gi|290766479|gb|ADD60242.1| alpha-form rubisco activase [Glycine max] gi|290766489|gb|ADD60247.1| alpha-form rubisco activase [Glycine max] Length = 478 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYT 122 FYGKAAQQV+IPVPEGCTDP A NFDPTARSDDG+CLYT Sbjct: 439 FYGKAAQQVNIPVPEGCTDPNASNFDPTARSDDGTCLYT 477 >gb|ESW13396.1| hypothetical protein PHAVU_008G192400g [Phaseolus vulgaris] Length = 477 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYT 122 FYGKAAQQV++PVPEGCTDP A NFDPTARSDDG+CLYT Sbjct: 438 FYGKAAQQVNVPVPEGCTDPNASNFDPTARSDDGTCLYT 476 >ref|XP_004490873.1| PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic-like [Cicer arietinum] Length = 476 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYTV 125 FYG+AAQQVH+PVPEGCTDP A NFDPTARSDDG+C+YT+ Sbjct: 437 FYGQAAQQVHVPVPEGCTDPNATNFDPTARSDDGTCVYTL 476 >ref|XP_004302722.1| PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 471 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLY 119 FYGKAAQQ+HIPVPEGCTDP A NFDPTARSD+GSCLY Sbjct: 432 FYGKAAQQIHIPVPEGCTDPSAANFDPTARSDNGSCLY 469 >ref|XP_002270571.2| PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic-like [Vitis vinifera] gi|297740331|emb|CBI30513.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYTV 125 FYGKAAQQV++PVPEGCTDP A NFDPTARSDDGSCLY + Sbjct: 435 FYGKAAQQVNLPVPEGCTDPSANNFDPTARSDDGSCLYQI 474 >ref|NP_001242531.1| ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic-like [Glycine max] gi|290766483|gb|ADD60244.1| rubisco activase [Glycine max] Length = 478 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYT 122 FYGKAAQQV IPVPEGCTDP A NFDPTARSDDG+CLYT Sbjct: 439 FYGKAAQQVKIPVPEGCTDPNASNFDPTARSDDGTCLYT 477 >ref|XP_006435642.1| hypothetical protein CICLE_v10031443mg [Citrus clementina] gi|568866090|ref|XP_006486397.1| PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic-like isoform X1 [Citrus sinensis] gi|557537838|gb|ESR48882.1| hypothetical protein CICLE_v10031443mg [Citrus clementina] Length = 465 Score = 78.6 bits (192), Expect = 8e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYTV 125 FYGKAAQQ+++PVPEGCTDP A+NFDPTARSDDGSC YT+ Sbjct: 426 FYGKAAQQMNVPVPEGCTDPTAENFDPTARSDDGSCQYTL 465 >ref|XP_006435641.1| hypothetical protein CICLE_v10031443mg [Citrus clementina] gi|557537837|gb|ESR48881.1| hypothetical protein CICLE_v10031443mg [Citrus clementina] Length = 463 Score = 78.6 bits (192), Expect = 8e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYTV 125 FYGKAAQQ+++PVPEGCTDP A+NFDPTARSDDGSC YT+ Sbjct: 424 FYGKAAQQMNVPVPEGCTDPTAENFDPTARSDDGSCQYTL 463 >ref|XP_006435638.1| hypothetical protein CICLE_v10031443mg [Citrus clementina] gi|557537834|gb|ESR48878.1| hypothetical protein CICLE_v10031443mg [Citrus clementina] Length = 375 Score = 78.6 bits (192), Expect = 8e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYTV 125 FYGKAAQQ+++PVPEGCTDP A+NFDPTARSDDGSC YT+ Sbjct: 336 FYGKAAQQMNVPVPEGCTDPTAENFDPTARSDDGSCQYTL 375 >ref|XP_006435637.1| hypothetical protein CICLE_v10031443mg [Citrus clementina] gi|557537833|gb|ESR48877.1| hypothetical protein CICLE_v10031443mg [Citrus clementina] Length = 347 Score = 78.6 bits (192), Expect = 8e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYTV 125 FYGKAAQQ+++PVPEGCTDP A+NFDPTARSDDGSC YT+ Sbjct: 308 FYGKAAQQMNVPVPEGCTDPTAENFDPTARSDDGSCQYTL 347 >ref|XP_002532996.1| Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplast precursor, putative [Ricinus communis] gi|223527225|gb|EEF29388.1| Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplast precursor, putative [Ricinus communis] Length = 474 Score = 78.6 bits (192), Expect = 8e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLY 119 FYGKAAQQV +PVPEGCTDP A+NFDPTARSDDGSCLY Sbjct: 435 FYGKAAQQVKVPVPEGCTDPSAENFDPTARSDDGSCLY 472 >ref|XP_006411205.1| hypothetical protein EUTSA_v10016600mg [Eutrema salsugineum] gi|557112374|gb|ESQ52658.1| hypothetical protein EUTSA_v10016600mg [Eutrema salsugineum] Length = 474 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLY 119 FYGK+AQQV++PVPEGCTDP AKNFDPTARSDDGSC+Y Sbjct: 435 FYGKSAQQVNLPVPEGCTDPSAKNFDPTARSDDGSCVY 472 >gb|EMJ22189.1| hypothetical protein PRUPE_ppa005158mg [Prunus persica] Length = 474 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLYT 122 FYGKAAQQV++PVPEGCTD A+NFDPTARSDDGSCLYT Sbjct: 435 FYGKAAQQVNVPVPEGCTDRTAENFDPTARSDDGSCLYT 473 >ref|XP_002971784.1| hypothetical protein SELMODRAFT_95817 [Selaginella moellendorffii] gi|300160916|gb|EFJ27533.1| hypothetical protein SELMODRAFT_95817 [Selaginella moellendorffii] Length = 451 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 9/75 (12%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLY---------TV*IYSCSSMHTF 158 FYGKAAQQ+++PVPEGCTDP A NFDPTARSDDG+C Y + + S+++ Sbjct: 378 FYGKAAQQINLPVPEGCTDPNAANFDPTARSDDGTCEYDFSAEASKPKISVADKSNIYGN 437 Query: 159 YYFIWQLLHCYTSLY 203 Y F+ L+ C+TS+Y Sbjct: 438 YLFV--LILCWTSVY 450 >ref|XP_002524206.1| Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplast precursor, putative [Ricinus communis] gi|223536483|gb|EEF38130.1| Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplast precursor, putative [Ricinus communis] Length = 473 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 6 FYGKAAQQVHIPVPEGCTDPIAKNFDPTARSDDGSCLY 119 FYGKAAQQV+IPVPEGCTDP A+NFDPTARSDDGSC Y Sbjct: 434 FYGKAAQQVNIPVPEGCTDPTAQNFDPTARSDDGSCTY 471