BLASTX nr result
ID: Zingiber23_contig00001967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00001967 (352 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004970336.1| PREDICTED: xylogen-like protein 11-like [Set... 57 2e-06 ref|XP_006646424.1| PREDICTED: xylogen-like protein 11-like [Ory... 55 7e-06 ref|XP_002441288.1| hypothetical protein SORBIDRAFT_09g023870 [S... 55 7e-06 ref|XP_002456525.1| hypothetical protein SORBIDRAFT_03g037810 [S... 55 7e-06 ref|XP_004961689.1| PREDICTED: xylogen-like protein 11-like [Set... 55 9e-06 >ref|XP_004970336.1| PREDICTED: xylogen-like protein 11-like [Setaria italica] Length = 193 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -3 Query: 350 ELAGTYDSYPICLCVLLAGGASSLGIPIDDGRALRLPSLCHL 225 ELAG +S+P+CLC LLAGGA S G+ +D RAL LP +C L Sbjct: 71 ELAGLLESHPVCLCQLLAGGAESYGVSVDYKRALALPGICRL 112 >ref|XP_006646424.1| PREDICTED: xylogen-like protein 11-like [Oryza brachyantha] Length = 188 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -3 Query: 350 ELAGTYDSYPICLCVLLAGGASSLGIPIDDGRALRLPSLCHL 225 ELAG DS P+CLC LLAGGASS I +D RAL LP +C L Sbjct: 76 ELAGLLDSKPVCLCQLLAGGASSYDISVDYKRALALPGICGL 117 >ref|XP_002441288.1| hypothetical protein SORBIDRAFT_09g023870 [Sorghum bicolor] gi|241946573|gb|EES19718.1| hypothetical protein SORBIDRAFT_09g023870 [Sorghum bicolor] Length = 210 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/51 (52%), Positives = 31/51 (60%) Frame = -3 Query: 350 ELAGTYDSYPICLCVLLAGGASSLGIPIDDGRALRLPSLCHLDDLSPDLCT 198 ELAG DS PICLC LL+G A S GI +D RAL LP +C + CT Sbjct: 80 ELAGLVDSNPICLCELLSGAADSYGIAVDYARALALPGICRVATPPVSTCT 130 >ref|XP_002456525.1| hypothetical protein SORBIDRAFT_03g037810 [Sorghum bicolor] gi|241928500|gb|EES01645.1| hypothetical protein SORBIDRAFT_03g037810 [Sorghum bicolor] Length = 190 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -3 Query: 350 ELAGTYDSYPICLCVLLAGGASSLGIPIDDGRALRLPSLCHL 225 E AG +S+P+CLC LLAGGA S G+ +D RAL LP +C L Sbjct: 73 EFAGLLESHPVCLCQLLAGGAESYGVSVDYKRALALPGICRL 114 >ref|XP_004961689.1| PREDICTED: xylogen-like protein 11-like [Setaria italica] Length = 218 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/51 (50%), Positives = 31/51 (60%) Frame = -3 Query: 350 ELAGTYDSYPICLCVLLAGGASSLGIPIDDGRALRLPSLCHLDDLSPDLCT 198 ELAG DS P+CLC LL+G A S GI +D RAL LP +C + CT Sbjct: 89 ELAGMVDSNPVCLCELLSGAADSYGIAVDYARALALPGICRVATPPVSTCT 139