BLASTX nr result
ID: Zingiber23_contig00001966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00001966 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004970336.1| PREDICTED: xylogen-like protein 11-like [Set... 57 2e-06 ref|XP_002456525.1| hypothetical protein SORBIDRAFT_03g037810 [S... 56 6e-06 >ref|XP_004970336.1| PREDICTED: xylogen-like protein 11-like [Setaria italica] Length = 193 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -3 Query: 429 ELAGTYESYPICLCVLIAGGANSLGIPIDDGRALRLPSLCHL 304 ELAG ES+P+CLC L+AGGA S G+ +D RAL LP +C L Sbjct: 71 ELAGLLESHPVCLCQLLAGGAESYGVSVDYKRALALPGICRL 112 >ref|XP_002456525.1| hypothetical protein SORBIDRAFT_03g037810 [Sorghum bicolor] gi|241928500|gb|EES01645.1| hypothetical protein SORBIDRAFT_03g037810 [Sorghum bicolor] Length = 190 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -3 Query: 429 ELAGTYESYPICLCVLIAGGANSLGIPIDDGRALRLPSLCHL 304 E AG ES+P+CLC L+AGGA S G+ +D RAL LP +C L Sbjct: 73 EFAGLLESHPVCLCQLLAGGAESYGVSVDYKRALALPGICRL 114