BLASTX nr result
ID: Zingiber23_contig00000266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00000266 (480 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517053.1| chloroplast inner envelope protein, putative... 66 5e-09 gb|EOY05836.1| S-adenosyl-L-methionine-dependent methyltransfera... 65 1e-08 ref|XP_004145369.1| PREDICTED: 37 kDa inner envelope membrane pr... 65 1e-08 gb|EXC16767.1| 37 kDa inner envelope membrane protein [Morus not... 64 2e-08 ref|XP_006420058.1| hypothetical protein CICLE_v10005361mg [Citr... 64 3e-08 gb|EOX94616.1| S-adenosyl-L-methionine-dependent methyltransfera... 63 5e-08 ref|XP_006443957.1| hypothetical protein CICLE_v10021032mg [Citr... 62 6e-08 gb|EPS61144.1| 2-methyl-6-phytylbenzoquinone methyltransferase, ... 62 6e-08 gb|EMJ02439.1| hypothetical protein PRUPE_ppa008168mg [Prunus pe... 62 6e-08 ref|XP_002520956.1| chloroplast inner envelope protein, putative... 62 6e-08 ref|XP_002307615.1| hypothetical protein POPTR_0005s23740g [Popu... 62 6e-08 gb|ABK96110.1| unknown [Populus trichocarpa] 62 6e-08 ref|XP_004234017.1| PREDICTED: 37 kDa inner envelope membrane pr... 62 8e-08 gb|AAF01212.1|AF181987_1 37 kDa chloroplast inner membrane prote... 62 8e-08 gb|EXB26551.1| 37 kDa inner envelope membrane protein [Morus not... 62 1e-07 gb|EMT04986.1| 37 kDa inner envelope membrane protein, chloropla... 62 1e-07 gb|EMS55629.1| 37 kDa inner envelope membrane protein, chloropla... 62 1e-07 dbj|BAJ86981.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 1e-07 ref|XP_006356041.1| PREDICTED: 2-methyl-6-phytyl-1,4-hydroquinon... 61 1e-07 dbj|BAL46505.1| MPBQ methyltransferase [Diospyros kaki] 61 1e-07 >ref|XP_002517053.1| chloroplast inner envelope protein, putative [Ricinus communis] gi|223543688|gb|EEF45216.1| chloroplast inner envelope protein, putative [Ricinus communis] Length = 341 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 FILGTIAATYYVLVPIYMWIKDQIVPKG PI Sbjct: 311 FILGTIAATYYVLVPIYMWIKDQIVPKGMPI 341 >gb|EOY05836.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily protein [Theobroma cacao] Length = 340 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F+LG IAATYYVLVPIYMW+KDQIVPKGQPI Sbjct: 310 FVLGAIAATYYVLVPIYMWLKDQIVPKGQPI 340 >ref|XP_004145369.1| PREDICTED: 37 kDa inner envelope membrane protein, chloroplastic-like [Cucumis sativus] gi|449473843|ref|XP_004153999.1| PREDICTED: 37 kDa inner envelope membrane protein, chloroplastic-like [Cucumis sativus] gi|449520769|ref|XP_004167405.1| PREDICTED: LOW QUALITY PROTEIN: 37 kDa inner envelope membrane protein, chloroplastic-like [Cucumis sativus] Length = 337 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 FILG +AATYYVLVPIYMWIKDQIVPKGQPI Sbjct: 307 FILGAMAATYYVLVPIYMWIKDQIVPKGQPI 337 >gb|EXC16767.1| 37 kDa inner envelope membrane protein [Morus notabilis] Length = 333 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F+LG IAATYYVLVPIYMWIKDQIVPKG+PI Sbjct: 303 FVLGAIAATYYVLVPIYMWIKDQIVPKGRPI 333 >ref|XP_006420058.1| hypothetical protein CICLE_v10005361mg [Citrus clementina] gi|567853878|ref|XP_006420059.1| hypothetical protein CICLE_v10005361mg [Citrus clementina] gi|568872649|ref|XP_006489479.1| PREDICTED: 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase, chloroplastic-like [Citrus sinensis] gi|557521931|gb|ESR33298.1| hypothetical protein CICLE_v10005361mg [Citrus clementina] gi|557521932|gb|ESR33299.1| hypothetical protein CICLE_v10005361mg [Citrus clementina] Length = 340 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 FILG IAATY+VLVPIYMW+KDQIVPKGQPI Sbjct: 310 FILGAIAATYFVLVPIYMWLKDQIVPKGQPI 340 >gb|EOX94616.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily protein [Theobroma cacao] Length = 341 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 FILG +AATYYVLVPIYMW+KDQIVP+GQPI Sbjct: 311 FILGAMAATYYVLVPIYMWVKDQIVPEGQPI 341 >ref|XP_006443957.1| hypothetical protein CICLE_v10021032mg [Citrus clementina] gi|568851906|ref|XP_006479626.1| PREDICTED: 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase, chloroplastic-like [Citrus sinensis] gi|557546219|gb|ESR57197.1| hypothetical protein CICLE_v10021032mg [Citrus clementina] Length = 337 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F+LG +AATY+VLVPIYMW+KDQIVPKGQPI Sbjct: 307 FVLGALAATYFVLVPIYMWLKDQIVPKGQPI 337 >gb|EPS61144.1| 2-methyl-6-phytylbenzoquinone methyltransferase, partial [Genlisea aurea] Length = 282 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F+LGT+AA Y+VLVPIYMW+KDQIVPKGQPI Sbjct: 252 FVLGTLAAAYFVLVPIYMWLKDQIVPKGQPI 282 >gb|EMJ02439.1| hypothetical protein PRUPE_ppa008168mg [Prunus persica] Length = 342 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 FILG +AATY+VLVPIYMW+KDQIVPKGQPI Sbjct: 312 FILGVMAATYFVLVPIYMWLKDQIVPKGQPI 342 >ref|XP_002520956.1| chloroplast inner envelope protein, putative [Ricinus communis] gi|223539793|gb|EEF41373.1| chloroplast inner envelope protein, putative [Ricinus communis] Length = 342 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 FILG +AATYYVLVPIYMW+KDQIVPKG+PI Sbjct: 312 FILGAMAATYYVLVPIYMWLKDQIVPKGRPI 342 >ref|XP_002307615.1| hypothetical protein POPTR_0005s23740g [Populus trichocarpa] gi|222857064|gb|EEE94611.1| hypothetical protein POPTR_0005s23740g [Populus trichocarpa] Length = 340 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 FILG +AATYYVLVPIYMW+KDQIVPKG+PI Sbjct: 310 FILGAMAATYYVLVPIYMWLKDQIVPKGRPI 340 >gb|ABK96110.1| unknown [Populus trichocarpa] Length = 241 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 FILG +AATYYVLVPIYMW+KDQIVPKG+PI Sbjct: 211 FILGVMAATYYVLVPIYMWLKDQIVPKGRPI 241 >ref|XP_004234017.1| PREDICTED: 37 kDa inner envelope membrane protein, chloroplastic-like [Solanum lycopersicum] Length = 338 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F+LG +AA+YYVLVPIYMWIKDQIVPKGQPI Sbjct: 308 FLLGIMAASYYVLVPIYMWIKDQIVPKGQPI 338 >gb|AAF01212.1|AF181987_1 37 kDa chloroplast inner membrane protein [Petunia x hybrida] Length = 68 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F+LG AATYYVLVPIYMW+KDQIVPKGQPI Sbjct: 38 FLLGITAATYYVLVPIYMWLKDQIVPKGQPI 68 >gb|EXB26551.1| 37 kDa inner envelope membrane protein [Morus notabilis] Length = 346 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 477 ILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 ILG +AATYYVLVPIYMW+KDQIVPKGQPI Sbjct: 317 ILGAMAATYYVLVPIYMWLKDQIVPKGQPI 346 >gb|EMT04986.1| 37 kDa inner envelope membrane protein, chloroplastic [Aegilops tauschii] Length = 327 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F +GTI A+YYVLVPIYMWIKDQ+VPKGQPI Sbjct: 297 FAIGTICASYYVLVPIYMWIKDQVVPKGQPI 327 >gb|EMS55629.1| 37 kDa inner envelope membrane protein, chloroplastic [Triticum urartu] Length = 435 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F +GTI A+YYVLVPIYMWIKDQ+VPKGQPI Sbjct: 405 FAIGTICASYYVLVPIYMWIKDQVVPKGQPI 435 >dbj|BAJ86981.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 198 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F +GTI A+YYVLVPIYMWIKDQ+VPKGQPI Sbjct: 168 FAIGTICASYYVLVPIYMWIKDQVVPKGQPI 198 >ref|XP_006356041.1| PREDICTED: 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase, chloroplastic-like [Solanum tuberosum] Length = 338 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 F+LG +AA+YYVLVPIYMW+KDQIVPKGQPI Sbjct: 308 FLLGIMAASYYVLVPIYMWLKDQIVPKGQPI 338 >dbj|BAL46505.1| MPBQ methyltransferase [Diospyros kaki] Length = 340 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 480 FILGTIAATYYVLVPIYMWIKDQIVPKGQPI 388 FILG AATYYVLVPIYMW+KDQIVPKG PI Sbjct: 310 FILGATAATYYVLVPIYMWLKDQIVPKGMPI 340