BLASTX nr result
ID: Zingiber23_contig00000088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00000088 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoaca... 103 3e-20 gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica] 103 3e-20 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus... 102 5e-20 gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus... 102 5e-20 ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula] gi... 102 5e-20 ref|XP_002280798.2| PREDICTED: cysteine proteinase RD19a-like [V... 102 5e-20 gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform... 102 7e-20 gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform... 102 7e-20 gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform... 102 7e-20 gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas] 102 7e-20 gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform... 102 7e-20 gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform... 102 7e-20 ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [S... 101 9e-20 gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum ... 101 9e-20 sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltNa... 100 2e-19 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus... 100 2e-19 ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Sol... 100 3e-19 ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum ... 100 3e-19 ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a isoform... 100 3e-19 ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a-like [S... 100 3e-19 >gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia] Length = 335 Score = 103 bits (256), Expect = 3e-20 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNTQQD 160 +PIRLK+KPYWIIKNSWG+SWGENGYYKICRG NVCGVDSMVSTV AV+T + Sbjct: 283 APIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVHTSHN 335 >gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica] Length = 292 Score = 103 bits (256), Expect = 3e-20 Identities = 43/50 (86%), Positives = 49/50 (98%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIRLK+KPYWIIKNSWG++WGENGYYKICRG NVCGVDSMVSTVTA++T Sbjct: 238 APIRLKEKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSMVSTVTAIHT 287 >gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris] Length = 366 Score = 102 bits (254), Expect = 5e-20 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR K+KP+WIIKNSWG+SWGENGYYKICRGHNVCGVDSMVSTV A++T Sbjct: 314 APIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHT 363 >gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris] Length = 366 Score = 102 bits (254), Expect = 5e-20 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR K+KP+WIIKNSWG+SWGENGYYKICRGHNVCGVDSMVSTV A++T Sbjct: 314 APIRFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHT 363 >ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula] gi|355508053|gb|AES89195.1| Cysteine proteinase [Medicago truncatula] Length = 362 Score = 102 bits (254), Expect = 5e-20 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 SPIRLK+KPYWIIKNSWG++WGENGYYKICRG N+CGVDSMVSTV AV+T Sbjct: 311 SPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAVHT 360 >ref|XP_002280798.2| PREDICTED: cysteine proteinase RD19a-like [Vitis vinifera] gi|147841854|emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera] gi|302142582|emb|CBI19785.3| unnamed protein product [Vitis vinifera] Length = 371 Score = 102 bits (254), Expect = 5e-20 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 SPIR K+KPYWIIKNSWG+SWGE GYYKICRGHN+CGVDSMVSTV A++T Sbjct: 319 SPIRFKEKPYWIIKNSWGESWGEQGYYKICRGHNICGVDSMVSTVAAIHT 368 >gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas] Length = 366 Score = 102 bits (253), Expect = 7e-20 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR+K+KPYWIIKNSWG+SWGENGYYKICRG NVCGVDSMVSTV AV+T Sbjct: 313 APIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST 362 >gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas] Length = 368 Score = 102 bits (253), Expect = 7e-20 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR+K+KPYWIIKNSWG+SWGENGYYKICRG NVCGVDSMVSTV AV+T Sbjct: 315 APIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST 364 >gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas] Length = 368 Score = 102 bits (253), Expect = 7e-20 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR+K+KPYWIIKNSWG+SWGENGYYKICRG NVCGVDSMVSTV AV+T Sbjct: 315 APIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST 364 >gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas] Length = 366 Score = 102 bits (253), Expect = 7e-20 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR+K+KPYWIIKNSWG+SWGENGYYKICRG NVCGVDSMVSTV AV+T Sbjct: 313 APIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST 362 >gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas] gi|7381223|gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas] Length = 366 Score = 102 bits (253), Expect = 7e-20 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR+K+KPYWIIKNSWG+SWGENGYYKICRG NVCGVDSMVSTV AV+T Sbjct: 313 APIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST 362 >gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas] Length = 368 Score = 102 bits (253), Expect = 7e-20 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR+K+KPYWIIKNSWG+SWGENGYYKICRG NVCGVDSMVSTV AV+T Sbjct: 315 APIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVST 364 >ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum] Length = 368 Score = 101 bits (252), Expect = 9e-20 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 SPIR+K+KPYWIIKNSWG+ WGENGYYKICRG NVCGVDSMVSTV AV+T Sbjct: 317 SPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVST 366 >gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena] Length = 363 Score = 101 bits (252), Expect = 9e-20 Identities = 41/50 (82%), Positives = 49/50 (98%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIRLK+KPYWIIKNSWG++WGE+GYYKICRGHN+CGVD+MVSTVTA +T Sbjct: 309 APIRLKEKPYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTATHT 358 >sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13 gi|18086|emb|CAA27609.1| pot. cysteine proteinase [Carica papaya] Length = 96 Score = 100 bits (250), Expect = 2e-19 Identities = 41/50 (82%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIRLK+KPYW+IKNSWG++WGENGYYKICRG N+CGVDSMVSTV AV+T Sbjct: 44 APIRLKEKPYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHT 93 >gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris] Length = 361 Score = 100 bits (249), Expect = 2e-19 Identities = 41/50 (82%), Positives = 48/50 (96%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR+K+KPYWIIKNSWG++WGENGYYKICRG N+CGVDSMVSTV AV+T Sbjct: 309 APIRMKEKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHT 358 >ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum] Length = 376 Score = 100 bits (248), Expect = 3e-19 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIRLK KPYWIIKNSWG +WGE+GYYKICRGHN+CGVD+MVSTVTA +T Sbjct: 322 APIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT 371 >ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum] Length = 363 Score = 100 bits (248), Expect = 3e-19 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIRLK KPYWIIKNSWG +WGE+GYYKICRGHN+CGVD+MVSTVTA +T Sbjct: 309 APIRLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT 358 >ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a isoform 1 [Vitis vinifera] gi|297735094|emb|CBI17456.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 100 bits (248), Expect = 3e-19 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 +PIR K+KPYWIIKNSWG+SWGE+GYYKICRGHN CGVDSMVSTV A+ T Sbjct: 315 APIRFKEKPYWIIKNSWGESWGEDGYYKICRGHNACGVDSMVSTVAAIQT 364 >ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a-like [Solanum lycopersicum] Length = 369 Score = 99.8 bits (247), Expect = 3e-19 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 SPIRLKKKPYWIIKNSWGDSWGENGYYKICRGHNVCGVDSMVSTVTAVNT 151 SPIR+K+KPYWIIKNSWG+ WGE+GYYKICRG NVCGVDSMVSTV AV+T Sbjct: 317 SPIRMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVST 366