BLASTX nr result
ID: Zanthoxylum22_contig00042944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00042944 (482 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010549223.1| PREDICTED: zinc finger protein 8-like [Taren... 57 4e-06 ref|XP_007029045.1| Uncharacterized protein TCM_024957 [Theobrom... 57 7e-06 >ref|XP_010549223.1| PREDICTED: zinc finger protein 8-like [Tarenaya hassleriana] Length = 238 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = -3 Query: 345 NAAADQRNPFVCFRCKKAFPTTQALGGHQNAHRKERPNKKDGGDDMPR 202 N+++ +R F C C K FPT+QALGGHQNAH++ER N K G P+ Sbjct: 83 NSSSSRRRRFECNYCYKNFPTSQALGGHQNAHKRERQNAKRGSTPPPQ 130 >ref|XP_007029045.1| Uncharacterized protein TCM_024957 [Theobroma cacao] gi|508717650|gb|EOY09547.1| Uncharacterized protein TCM_024957 [Theobroma cacao] Length = 247 Score = 56.6 bits (135), Expect = 7e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 321 PFVCFRCKKAFPTTQALGGHQNAHRKERPNKK 226 PFVC+RC K FP+T ALGGHQNAH+KER ++ Sbjct: 36 PFVCYRCSKRFPSTHALGGHQNAHKKERNEER 67