BLASTX nr result
ID: Zanthoxylum22_contig00042513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00042513 (390 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCD58743.1| unnamed protein product [Schistosoma mansoni] 50 1e-12 emb|CDS20307.1| hypothetical protein EgrG_000335800 [Echinococcu... 72 2e-10 ref|XP_006455550.1| hypothetical protein AGABI2DRAFT_75975, part... 46 2e-09 gb|KIK49843.1| hypothetical protein GYMLUDRAFT_78612 [Gymnopus l... 48 2e-09 gb|ELT98715.1| hypothetical protein CAPTEDRAFT_61794, partial [C... 46 3e-09 gb|KDQ49126.1| hypothetical protein JAAARDRAFT_143876, partial [... 45 3e-09 ref|XP_007405673.1| hypothetical protein MELLADRAFT_92517 [Melam... 44 1e-08 ref|XP_008037273.1| hypothetical protein TRAVEDRAFT_36643 [Trame... 43 1e-08 ref|XP_009550271.1| hypothetical protein HETIRDRAFT_421044 [Hete... 43 1e-08 ref|XP_007311851.1| hypothetical protein STEHIDRAFT_23631, parti... 43 1e-08 ref|XP_007324730.1| hypothetical protein SERLADRAFT_353212 [Serp... 43 1e-08 ref|XP_001887546.1| predicted protein [Laccaria bicolor S238N-H8... 44 1e-08 ref|XP_007419020.1| hypothetical protein MELLADRAFT_84525 [Melam... 44 2e-08 ref|XP_007419023.1| hypothetical protein MELLADRAFT_84531 [Melam... 44 2e-08 ref|XP_007415539.1| hypothetical protein MELLADRAFT_92706 [Melam... 44 2e-08 ref|XP_007414632.1| hypothetical protein MELLADRAFT_91701 [Melam... 44 2e-08 ref|XP_007417426.1| hypothetical protein MELLADRAFT_94723 [Melam... 44 2e-08 ref|XP_007410495.1| hypothetical protein MELLADRAFT_87416 [Melam... 44 2e-08 ref|XP_007416288.1| hypothetical protein MELLADRAFT_93283 [Melam... 44 2e-08 ref|XP_007411659.1| hypothetical protein MELLADRAFT_88128 [Melam... 44 2e-08 >emb|CCD58743.1| unnamed protein product [Schistosoma mansoni] Length = 98 Score = 50.4 bits (119), Expect(2) = 1e-12 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +2 Query: 221 RVRHINETFGSSHSASPAYQGWPTYNRESESPF 319 RVRH+N TFGSSHSAS AYQ WPT++ S F Sbjct: 62 RVRHLNRTFGSSHSASSAYQKWPTWHSHSMQNF 94 Score = 49.3 bits (116), Expect(2) = 1e-12 Identities = 27/56 (48%), Positives = 32/56 (57%) Frame = +1 Query: 40 PRHTSVPRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PRHT+ + IHF+ +R VSCYTLLS RLPWP S CL + FVV Sbjct: 2 PRHTNYSNGPVWVQCSSAIHFQGWLIRQVSCYTLLSGFRLPWPPSCCLDQPAPFVV 57 >emb|CDS20307.1| hypothetical protein EgrG_000335800 [Echinococcus granulosus] Length = 209 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/57 (56%), Positives = 38/57 (66%) Frame = +2 Query: 146 ADADFHGHSPAVLEREESLW*SCAARVRHINETFGSSHSASPAYQGWPTYNRESESP 316 ADADFHGH PAV + LW + VRH+N FGSSHSAS AYQ WPT++ + P Sbjct: 69 ADADFHGHRPAVYINQHLLWYLMSVSVRHLNRAFGSSHSASSAYQKWPTWHSHIQRP 125 >ref|XP_006455550.1| hypothetical protein AGABI2DRAFT_75975, partial [Agaricus bisporus var. bisporus H97] gi|598002747|ref|XP_007335031.1| hypothetical protein AGABI1DRAFT_48198, partial [Agaricus bisporus var. burnettii JB137-S8] gi|598005867|ref|XP_007335729.1| hypothetical protein AGABI1DRAFT_49524, partial [Agaricus bisporus var. burnettii JB137-S8] gi|409072330|gb|EKM73631.1| hypothetical protein AGABI1DRAFT_49524, partial [Agaricus bisporus var. burnettii JB137-S8] gi|409073858|gb|EKM74330.1| hypothetical protein AGABI1DRAFT_48198, partial [Agaricus bisporus var. burnettii JB137-S8] gi|426194357|gb|EKV44289.1| hypothetical protein AGABI2DRAFT_75975, partial [Agaricus bisporus var. bisporus H97] Length = 93 Score = 45.8 bits (107), Expect(2) = 2e-09 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSS AS AYQ WPT R S+SP SIKKR Sbjct: 39 RHLNLAFGSSRIASSAYQKWPT--RNSQSPSGSIKKR 73 Score = 43.1 bits (100), Expect(2) = 2e-09 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +1 Query: 115 LRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 +R VSCYTLLS RLPWP S CL E FVV Sbjct: 2 IRQVSCYTLLSGFRLPWPPSCCLDELTPFVV 32 >gb|KIK49843.1| hypothetical protein GYMLUDRAFT_78612 [Gymnopus luxurians FD-317 M1] Length = 243 Score = 48.1 bits (113), Expect(2) = 2e-09 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +1 Query: 103 RPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 +P PL +VSCYTLLS RLPWP S CL E FVV Sbjct: 122 KPVPLAVVSCYTLLSGFRLPWPPSCCLDELTPFVV 156 Score = 40.4 bits (93), Expect(2) = 2e-09 Identities = 18/32 (56%), Positives = 19/32 (59%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFC 322 RH+N FGSS AS AYQ WPT N FC Sbjct: 163 RHLNLAFGSSRIASSAYQKWPTRNSSIAERFC 194 >gb|ELT98715.1| hypothetical protein CAPTEDRAFT_61794, partial [Capitella teleta] Length = 66 Score = 46.2 bits (108), Expect(2) = 3e-09 Identities = 22/40 (55%), Positives = 24/40 (60%) Frame = +1 Query: 115 LRLVSCYTLLS*CRLPWPQSSCLRERRIFVVVLCSPRTTH 234 +R VSCYTLLS CRLPWP S CL F+ PR H Sbjct: 2 IRQVSCYTLLSGCRLPWPPSCCLYPPTPFLGSAVRPRVGH 41 Score = 42.0 bits (97), Expect(2) = 3e-09 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 221 RVRHINETFGSSHSASPAYQGWPT 292 RV H+N FGSSHSAS AYQ WPT Sbjct: 38 RVGHLNPPFGSSHSASSAYQKWPT 61 >gb|KDQ49126.1| hypothetical protein JAAARDRAFT_143876, partial [Jaapia argillacea MUCL 33604] gi|646383652|gb|KDQ49133.1| hypothetical protein JAAARDRAFT_114037, partial [Jaapia argillacea MUCL 33604] Length = 93 Score = 45.1 bits (105), Expect(2) = 3e-09 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = +2 Query: 221 RVRHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 + RH+N TFGSS AS AYQ WPT R S+SP IK+R Sbjct: 37 KFRHLNLTFGSSRIASSAYQKWPT--RNSQSPSGPIKRR 73 Score = 43.1 bits (100), Expect(2) = 3e-09 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +1 Query: 115 LRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 +R VSCYTLLS RLPWP S CL E FVV Sbjct: 2 IRQVSCYTLLSGFRLPWPPSCCLDEPTPFVV 32 >ref|XP_007405673.1| hypothetical protein MELLADRAFT_92517 [Melampsora larici-populina 98AG31] gi|328861969|gb|EGG11071.1| hypothetical protein MELLADRAFT_92517 [Melampsora larici-populina 98AG31] Length = 198 Score = 44.3 bits (103), Expect(2) = 1e-08 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +1 Query: 58 PRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PR + + PL + RP +SCYTLLS RLPWP CL E FVV Sbjct: 48 PRSALKAAPLNITFIRP-----LSCYTLLSGFRLPWPPCGCLDELTPFVV 92 Score = 41.6 bits (96), Expect(2) = 1e-08 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKRT 340 RH+N FGSSH AS AYQ WPT ++ S SIKK++ Sbjct: 99 RHLNSAFGSSHIASSAYQKWPT--KDFYSCTSSIKKQS 134 >ref|XP_008037273.1| hypothetical protein TRAVEDRAFT_36643 [Trametes versicolor FP-101664 SS1] gi|392565970|gb|EIW59146.1| hypothetical protein TRAVEDRAFT_36643 [Trametes versicolor FP-101664 SS1] Length = 112 Score = 43.1 bits (100), Expect(2) = 1e-08 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +1 Query: 115 LRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 +R VSCYTLLS RLPWP S CL E FVV Sbjct: 21 IRQVSCYTLLSGFRLPWPPSCCLDELTPFVV 51 Score = 42.7 bits (99), Expect(2) = 1e-08 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSS AS AYQ WPT R S+SP IK+R Sbjct: 58 RHLNLAFGSSRIASSAYQKWPT--RNSQSPSGPIKRR 92 >ref|XP_009550271.1| hypothetical protein HETIRDRAFT_421044 [Heterobasidion irregulare TC 32-1] gi|449540879|gb|EMD31867.1| hypothetical protein CERSUDRAFT_109224 [Gelatoporia subvermispora B] gi|575062672|gb|ETW78290.1| hypothetical protein HETIRDRAFT_421044 [Heterobasidion irregulare TC 32-1] Length = 103 Score = 43.1 bits (100), Expect(2) = 1e-08 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +1 Query: 115 LRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 +R VSCYTLLS RLPWP S CL E FVV Sbjct: 12 IRQVSCYTLLSGFRLPWPPSCCLDELTPFVV 42 Score = 42.7 bits (99), Expect(2) = 1e-08 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSS AS AYQ WPT R S+SP IK+R Sbjct: 49 RHLNLAFGSSRIASSAYQKWPT--RNSQSPSGPIKRR 83 >ref|XP_007311851.1| hypothetical protein STEHIDRAFT_23631, partial [Stereum hirsutum FP-91666 SS1] gi|618818794|ref|XP_007311972.1| hypothetical protein STEHIDRAFT_70108, partial [Stereum hirsutum FP-91666 SS1] gi|636629127|ref|XP_008045698.1| hypothetical protein TRAVEDRAFT_137430, partial [Trametes versicolor FP-101664 SS1] gi|350295075|gb|EGZ76071.1| hypothetical protein NEUTE2DRAFT_76164, partial [Neurospora tetrasperma FGSC 2509] gi|389737600|gb|EIM78931.1| hypothetical protein STEHIDRAFT_70108, partial [Stereum hirsutum FP-91666 SS1] gi|389737822|gb|EIM79048.1| hypothetical protein STEHIDRAFT_23631, partial [Stereum hirsutum FP-91666 SS1] gi|392558216|gb|EIW51411.1| hypothetical protein TRAVEDRAFT_137430, partial [Trametes versicolor FP-101664 SS1] Length = 93 Score = 43.1 bits (100), Expect(2) = 1e-08 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +1 Query: 115 LRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 +R VSCYTLLS RLPWP S CL E FVV Sbjct: 2 IRQVSCYTLLSGFRLPWPPSCCLDELTPFVV 32 Score = 42.7 bits (99), Expect(2) = 1e-08 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSS AS AYQ WPT R S+SP IK+R Sbjct: 39 RHLNLAFGSSRIASSAYQKWPT--RNSQSPSGPIKRR 73 >ref|XP_007324730.1| hypothetical protein SERLADRAFT_353212 [Serpula lacrymans var. lacrymans S7.9] gi|597940791|ref|XP_007324739.1| hypothetical protein SERLADRAFT_353292, partial [Serpula lacrymans var. lacrymans S7.9] gi|597940797|ref|XP_007324742.1| hypothetical protein SERLADRAFT_353306, partial [Serpula lacrymans var. lacrymans S7.9] gi|597940805|ref|XP_007324746.1| hypothetical protein SERLADRAFT_353235, partial [Serpula lacrymans var. lacrymans S7.9] gi|336362616|gb|EGN91347.1| hypothetical protein SERLA73DRAFT_67568, partial [Serpula lacrymans var. lacrymans S7.3] gi|336362735|gb|EGN91395.1| hypothetical protein SERLA73DRAFT_67493, partial [Serpula lacrymans var. lacrymans S7.3] gi|336362983|gb|EGN91491.1| hypothetical protein SERLA73DRAFT_67318, partial [Serpula lacrymans var. lacrymans S7.3] gi|336377541|gb|EGO18703.1| hypothetical protein SERLADRAFT_353212, partial [Serpula lacrymans var. lacrymans S7.9] gi|336377550|gb|EGO18712.1| hypothetical protein SERLADRAFT_353292, partial [Serpula lacrymans var. lacrymans S7.9] gi|336377553|gb|EGO18715.1| hypothetical protein SERLADRAFT_353306, partial [Serpula lacrymans var. lacrymans S7.9] gi|336377557|gb|EGO18719.1| hypothetical protein SERLADRAFT_353235, partial [Serpula lacrymans var. lacrymans S7.9] Length = 93 Score = 43.1 bits (100), Expect(2) = 1e-08 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +1 Query: 115 LRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 +R VSCYTLLS RLPWP S CL E FVV Sbjct: 2 IRQVSCYTLLSGFRLPWPPSCCLDELTPFVV 32 Score = 42.7 bits (99), Expect(2) = 1e-08 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSS AS AYQ WPT R S+SP IK+R Sbjct: 39 RHLNLAFGSSRIASSAYQKWPT--RNSQSPSGPIKRR 73 >ref|XP_001887546.1| predicted protein [Laccaria bicolor S238N-H82] gi|164637448|gb|EDR01733.1| predicted protein, partial [Laccaria bicolor S238N-H82] Length = 93 Score = 44.3 bits (103), Expect(2) = 1e-08 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N F SSH AS AYQ WPT R S+SP IK+R Sbjct: 39 RHLNLAFSSSHIASSAYQKWPT--RNSQSPSSPIKRR 73 Score = 41.6 bits (96), Expect(2) = 1e-08 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +1 Query: 115 LRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 +R VSCYTLLS R PWP S CL E FVV Sbjct: 2 IRQVSCYTLLSGFRFPWPPSCCLDELTPFVV 32 >ref|XP_007419020.1| hypothetical protein MELLADRAFT_84525 [Melampsora larici-populina 98AG31] gi|328848484|gb|EGF97697.1| hypothetical protein MELLADRAFT_84525 [Melampsora larici-populina 98AG31] Length = 347 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +1 Query: 58 PRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PR + + PL + RP +SCYTLLS RLPWP CL E FVV Sbjct: 186 PRSALKAAPLNITFIRP-----LSCYTLLSGFRLPWPPCGCLDELTPFVV 230 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSSH AS AYQ WPT ++ S SIKK+ Sbjct: 237 RHLNSAFGSSHIASSAYQKWPT--KDFYSCTSSIKKQ 271 >ref|XP_007419023.1| hypothetical protein MELLADRAFT_84531 [Melampsora larici-populina 98AG31] gi|328848487|gb|EGF97700.1| hypothetical protein MELLADRAFT_84531 [Melampsora larici-populina 98AG31] Length = 314 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +1 Query: 58 PRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PR + + PL + RP +SCYTLLS RLPWP CL E FVV Sbjct: 48 PRSALKAAPLNITFIRP-----LSCYTLLSGFRLPWPPCGCLDELTPFVV 92 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSSH AS AYQ WPT ++ S SIKK+ Sbjct: 99 RHLNSAFGSSHIASSAYQKWPT--KDFYSCTSSIKKQ 133 >ref|XP_007415539.1| hypothetical protein MELLADRAFT_92706 [Melampsora larici-populina 98AG31] gi|328852040|gb|EGG01189.1| hypothetical protein MELLADRAFT_92706 [Melampsora larici-populina 98AG31] Length = 289 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +1 Query: 58 PRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PR + + PL + RP +SCYTLLS RLPWP CL E FVV Sbjct: 48 PRSALKAAPLNITFIRP-----LSCYTLLSGFRLPWPPCGCLDELTPFVV 92 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSSH AS AYQ WPT ++ S SIKK+ Sbjct: 99 RHLNSAFGSSHIASSAYQKWPT--KDFYSCTSSIKKQ 133 >ref|XP_007414632.1| hypothetical protein MELLADRAFT_91701 [Melampsora larici-populina 98AG31] gi|328852953|gb|EGG02095.1| hypothetical protein MELLADRAFT_91701 [Melampsora larici-populina 98AG31] Length = 250 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +1 Query: 58 PRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PR + + PL + RP +SCYTLLS RLPWP CL E FVV Sbjct: 48 PRSALKAAPLNITFIRP-----LSCYTLLSGFRLPWPPCGCLDELTPFVV 92 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSSH AS AYQ WPT ++ S SIKK+ Sbjct: 99 RHLNSAFGSSHIASSAYQKWPT--KDFYSCTSSIKKQ 133 >ref|XP_007417426.1| hypothetical protein MELLADRAFT_94723 [Melampsora larici-populina 98AG31] gi|328850157|gb|EGF99326.1| hypothetical protein MELLADRAFT_94723 [Melampsora larici-populina 98AG31] Length = 244 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +1 Query: 58 PRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PR + + PL + RP +SCYTLLS RLPWP CL E FVV Sbjct: 48 PRSALKAAPLNITFIRP-----LSCYTLLSGFRLPWPPCGCLDELTPFVV 92 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSSH AS AYQ WPT ++ S SIKK+ Sbjct: 99 RHLNSAFGSSHIASSAYQKWPT--KDFYSCTSSIKKQ 133 >ref|XP_007410495.1| hypothetical protein MELLADRAFT_87416 [Melampsora larici-populina 98AG31] gi|328857139|gb|EGG06257.1| hypothetical protein MELLADRAFT_87416 [Melampsora larici-populina 98AG31] Length = 209 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +1 Query: 58 PRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PR + + PL + RP +SCYTLLS RLPWP CL E FVV Sbjct: 48 PRSALKAAPLNITFIRP-----LSCYTLLSGFRLPWPPCGCLDELTPFVV 92 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSSH AS AYQ WPT ++ S SIKK+ Sbjct: 99 RHLNSVFGSSHIASSAYQKWPT--KDFYSCTSSIKKQ 133 >ref|XP_007416288.1| hypothetical protein MELLADRAFT_93283 [Melampsora larici-populina 98AG31] gi|599426085|ref|XP_007417782.1| hypothetical protein MELLADRAFT_95026 [Melampsora larici-populina 98AG31] gi|328849782|gb|EGF98956.1| hypothetical protein MELLADRAFT_95026 [Melampsora larici-populina 98AG31] gi|328851286|gb|EGG00442.1| hypothetical protein MELLADRAFT_93283 [Melampsora larici-populina 98AG31] Length = 209 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +1 Query: 58 PRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PR + + PL + RP +SCYTLLS RLPWP CL E FVV Sbjct: 48 PRSALKAAPLNITFIRP-----LSCYTLLSGFRLPWPPCGCLDELTPFVV 92 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSSH AS AYQ WPT ++ S SIKK+ Sbjct: 99 RHLNSAFGSSHIASSAYQKWPT--KDFYSCTSSIKKQ 133 >ref|XP_007411659.1| hypothetical protein MELLADRAFT_88128 [Melampsora larici-populina 98AG31] gi|599424942|ref|XP_007417434.1| hypothetical protein MELLADRAFT_94732 [Melampsora larici-populina 98AG31] gi|599424954|ref|XP_007417438.1| hypothetical protein MELLADRAFT_94737 [Melampsora larici-populina 98AG31] gi|599429223|ref|XP_007418755.1| hypothetical protein MELLADRAFT_84125 [Melampsora larici-populina 98AG31] gi|328848780|gb|EGF97978.1| hypothetical protein MELLADRAFT_84125 [Melampsora larici-populina 98AG31] gi|328850147|gb|EGF99316.1| hypothetical protein MELLADRAFT_94737 [Melampsora larici-populina 98AG31] gi|328850150|gb|EGF99319.1| hypothetical protein MELLADRAFT_94732 [Melampsora larici-populina 98AG31] gi|328856171|gb|EGG05294.1| hypothetical protein MELLADRAFT_88128 [Melampsora larici-populina 98AG31] Length = 172 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = +1 Query: 58 PRRSGMSLPLTVIHFRPPPLRLVSCYTLLS*CRLPWPQSSCLRERRIFVV 207 PR + + PL + RP +SCYTLLS RLPWP CL E FVV Sbjct: 48 PRSALKAAPLNITFIRP-----LSCYTLLSGFRLPWPPCGCLDELTPFVV 92 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +2 Query: 227 RHINETFGSSHSASPAYQGWPTYNRESESPFCSIKKR 337 RH+N FGSSH AS AYQ WPT ++ S SIKK+ Sbjct: 99 RHLNSAFGSSHIASSAYQKWPT--KDFYSCTSSIKKQ 133