BLASTX nr result
ID: Zanthoxylum22_contig00041970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00041970 (272 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERG85329.1| 60s ribosomal protein l35 [Ascaris suum] 81 4e-13 gb|AFJ92676.1| large ribosomal protein 35, partial [Parapristion... 80 5e-13 gb|ACV21054.1| large subunit ribosomal protein 35, partial [Koer... 80 6e-13 gb|ELU10173.1| hypothetical protein CAPTEDRAFT_149132 [Capitella... 79 1e-12 ref|XP_009048426.1| hypothetical protein LOTGIDRAFT_151505 [Lott... 79 1e-12 gb|ACV21041.1| large subunit ribosomal protein 35, partial [Rhab... 79 1e-12 gb|AIL48401.1| large subunit ribosomal protein 35, partial [Fict... 79 2e-12 gb|AIL48400.1| large subunit ribosomal protein 35, partial [Fict... 79 2e-12 gb|AIL48414.1| large subunit ribosomal protein 35, partial [Dipl... 77 4e-12 gb|AIL48412.1| large subunit ribosomal protein 35, partial [Oigo... 77 4e-12 gb|ACV21049.1| large subunit ribosomal protein 35, partial [Dipl... 77 4e-12 gb|AAY66958.1| ribosomal protein L35 [Ixodes scapularis] 77 4e-12 ref|XP_002410105.1| ribosomal protein L35, putative [Ixodes scap... 77 4e-12 gb|ACD65181.1| putative 60S ribosomal protein RPL35 [Phoronis mu... 77 5e-12 gb|AGJ74553.1| large subunit ribosomal protein 35, partial [Pris... 77 5e-12 gb|EKG19603.1| Ribosomal protein L29 [Macrophomina phaseolina MS6] 77 5e-12 gb|ABW90366.1| putative ribosomal protein L35 [Sipunculus nudus] 77 5e-12 gb|ABK55652.1| RPL35 [Sus scrofa] 77 5e-12 gb|KOO21433.1| 60s ribosomal protein l35 [Chrysochromulina sp. C... 77 7e-12 gb|KKA71825.1| ribosomal protein [Pristionchus pacificus] 77 7e-12 >gb|ERG85329.1| 60s ribosomal protein l35 [Ascaris suum] Length = 123 Score = 80.9 bits (198), Expect = 4e-13 Identities = 40/78 (51%), Positives = 57/78 (73%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK+IAR+LTVINQTQ+++LR+FYKG+K P L++K++R R ALTP + S Sbjct: 46 KIRTVRKNIARILTVINQTQKQELRKFYKGKKLKPLDLRLKKTRAMRRALTPHEASLKSA 105 Query: 90 KVRIHKQKFPALVFSVKA 37 K ++KFP +++KA Sbjct: 106 KQLAKQRKFPLRKYALKA 123 >gb|AFJ92676.1| large ribosomal protein 35, partial [Parapristionchus giblindavisi] Length = 115 Score = 80.5 bits (197), Expect = 5e-13 Identities = 41/78 (52%), Positives = 56/78 (71%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK++ARVLTVINQTQ+++LR+FYKG+K +P L+ K++R R ALT +KS Sbjct: 38 KIRTVRKNVARVLTVINQTQKQELRKFYKGKKYLPTDLRFKKTRAMRRALTKHEKSIKTP 97 Query: 90 KVRIHKQKFPALVFSVKA 37 K ++ FP F+VKA Sbjct: 98 KQLAKERAFPLRKFAVKA 115 >gb|ACV21054.1| large subunit ribosomal protein 35, partial [Koerneria sudhausi] Length = 115 Score = 80.1 bits (196), Expect = 6e-13 Identities = 40/78 (51%), Positives = 56/78 (71%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK+IARVLTV+NQTQ+++LR+FYKG+K +P L+ +++R R ALT ++S Sbjct: 38 KIRTVRKNIARVLTVVNQTQKQELRKFYKGKKYLPTDLRYRKTRAMRRALTKHEQSLKTA 97 Query: 90 KVRIHKQKFPALVFSVKA 37 K +KFP F+VKA Sbjct: 98 KQAAKDRKFPQRKFAVKA 115 >gb|ELU10173.1| hypothetical protein CAPTEDRAFT_149132 [Capitella teleta] Length = 123 Score = 79.3 bits (194), Expect = 1e-12 Identities = 41/78 (52%), Positives = 55/78 (70%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRKSIARV+TVINQTQ+E LR+FY+ +K MPK L+ K++R R ALTP ++S R Sbjct: 46 KIRIVRKSIARVMTVINQTQKENLRKFYRDKKYMPKDLRPKKTRAMRRALTPHERSLKTR 105 Query: 90 KVRIHKQKFPALVFSVKA 37 K +P +++KA Sbjct: 106 KQARKDSLYPLRKYALKA 123 >ref|XP_009048426.1| hypothetical protein LOTGIDRAFT_151505 [Lottia gigantea] gi|556112238|gb|ESP00890.1| hypothetical protein LOTGIDRAFT_151505 [Lottia gigantea] Length = 123 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/78 (51%), Positives = 56/78 (71%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRKS+ RVLTV+NQT++E LR+FYK +K +PKQL+ K++R R +LT +K+ + Sbjct: 46 KIRTVRKSVGRVLTVMNQTRKENLRKFYKKKKWVPKQLRRKKTRAIRRSLTDNEKNIKSK 105 Query: 90 KVRIHKQKFPALVFSVKA 37 K R Q FP F+VK+ Sbjct: 106 KARRKAQNFPMRKFAVKS 123 >gb|ACV21041.1| large subunit ribosomal protein 35, partial [Rhabditidoides sp. RS5443] Length = 115 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/78 (51%), Positives = 55/78 (70%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK++AR+LTVINQTQ+++LR+FYKG+ P L+ K++R R ALT +KS Sbjct: 38 KIRTVRKNVARILTVINQTQKQELRKFYKGKAHKPTDLRYKKTRAIRRALTKHEKSIKTP 97 Query: 90 KVRIHKQKFPALVFSVKA 37 K ++KFP F+VKA Sbjct: 98 KQLAKERKFPLRKFAVKA 115 >gb|AIL48401.1| large subunit ribosomal protein 35, partial [Fictor sp. 2 VS-2014] Length = 123 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/78 (51%), Positives = 54/78 (69%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK++AR+LTVINQTQ+ +LR+FY G+K P L+ K++R R ALT +KS Sbjct: 46 KIREVRKNVARILTVINQTQKAELRKFYAGKKYKPTDLRYKKTRAMRRALTKHEKSIKSA 105 Query: 90 KVRIHKQKFPALVFSVKA 37 K + +KFP F+VKA Sbjct: 106 KQQAKARKFPIRKFAVKA 123 >gb|AIL48400.1| large subunit ribosomal protein 35, partial [Fictor sp. 1 VS-2014] Length = 123 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/78 (51%), Positives = 54/78 (69%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK++AR+LTVINQTQ+ +LR+FY G+K P L+ K++R R ALT +KS Sbjct: 46 KIREVRKNVARILTVINQTQKAELRKFYAGKKYKPTDLRYKKTRAMRRALTKHEKSIKSA 105 Query: 90 KVRIHKQKFPALVFSVKA 37 K + +KFP F+VKA Sbjct: 106 KQQAKARKFPIRKFAVKA 123 >gb|AIL48414.1| large subunit ribosomal protein 35, partial [Diplogastridae gen. 1 sp. 1 EJR-2014] Length = 120 Score = 77.4 bits (189), Expect = 4e-12 Identities = 40/78 (51%), Positives = 54/78 (69%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK+IARVLTVINQTQ+++LR+FYKG+ P ++ K++R R ALT ++S Sbjct: 43 KIRTVRKNIARVLTVINQTQKQELRKFYKGKHYKPLDIRFKKTRAMRRALTKHERSLKSP 102 Query: 90 KVRIHKQKFPALVFSVKA 37 K + KFP F+VKA Sbjct: 103 KALARQGKFPQRKFAVKA 120 >gb|AIL48412.1| large subunit ribosomal protein 35, partial [Oigolaimella sp. VS-2014] Length = 123 Score = 77.4 bits (189), Expect = 4e-12 Identities = 39/78 (50%), Positives = 56/78 (71%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KI VRK+IAR+LTVINQTQ+++LR+FYKG++ P L+ K++R R ALT K+ S + Sbjct: 46 KISVVRKNIARILTVINQTQKQELRKFYKGKQHKPTDLRFKKTRAMRRALTKKEASIKTQ 105 Query: 90 KVRIHKQKFPALVFSVKA 37 K +++FP F+VKA Sbjct: 106 KQARRERQFPLRRFAVKA 123 >gb|ACV21049.1| large subunit ribosomal protein 35, partial [Diplogasteroides magnus] Length = 115 Score = 77.4 bits (189), Expect = 4e-12 Identities = 40/78 (51%), Positives = 54/78 (69%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK+IARVLTV+NQTQ+++LR+FYKG+ P L+ K++R R ALT + S Sbjct: 38 KIRTVRKNIARVLTVVNQTQKQELRKFYKGKALKPTDLRYKKTRAMRRALTKHEASIKTA 97 Query: 90 KVRIHKQKFPALVFSVKA 37 K ++KFP F+VKA Sbjct: 98 KQLAKERKFPLRKFAVKA 115 >gb|AAY66958.1| ribosomal protein L35 [Ixodes scapularis] Length = 123 Score = 77.4 bits (189), Expect = 4e-12 Identities = 41/77 (53%), Positives = 53/77 (68%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRKSIARVLTVI+QTQ+E LR+FY+G+K PK L+ K +R KR LTP +K+ R Sbjct: 46 KIRVVRKSIARVLTVIHQTQKENLRKFYRGKKHKPKDLRPKLTRAKRRELTPHEKALRTR 105 Query: 90 KVRIHKQKFPALVFSVK 40 K +P F++K Sbjct: 106 KELRRMAAYPHRKFALK 122 >ref|XP_002410105.1| ribosomal protein L35, putative [Ixodes scapularis] gi|51011568|gb|AAT92193.1| 60S ribosomal protein L35-like protein [Ixodes pacificus] gi|215494727|gb|EEC04368.1| ribosomal protein L35, putative [Ixodes scapularis] Length = 123 Score = 77.4 bits (189), Expect = 4e-12 Identities = 41/77 (53%), Positives = 53/77 (68%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRKSIARVLTVI+QTQ+E LR+FY+G+K PK L+ K +R KR LTP +K+ R Sbjct: 46 KIRVVRKSIARVLTVIHQTQKENLRKFYRGKKHKPKDLRPKLTRAKRRELTPHEKALRTR 105 Query: 90 KVRIHKQKFPALVFSVK 40 K +P F++K Sbjct: 106 KELRRMAAYPHRKFALK 122 >gb|ACD65181.1| putative 60S ribosomal protein RPL35 [Phoronis muelleri] Length = 123 Score = 77.0 bits (188), Expect = 5e-12 Identities = 39/78 (50%), Positives = 53/78 (67%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRKSIAR+ TVINQTQ+E LR+FYKG+K P L++K++R R AL + S Sbjct: 46 KIRDVRKSIARISTVINQTQKENLRKFYKGKKYKPIDLRMKKTRAIRRALNKHESSITTA 105 Query: 90 KVRIHKQKFPALVFSVKA 37 K + ++ FP F++KA Sbjct: 106 KFQARQRAFPVRKFAIKA 123 >gb|AGJ74553.1| large subunit ribosomal protein 35, partial [Pristionchus bucculentus] Length = 115 Score = 77.0 bits (188), Expect = 5e-12 Identities = 41/78 (52%), Positives = 54/78 (69%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK+IARVLTVINQTQ+++LR+FYKG+K +P L+ K++R R ALT + S Sbjct: 38 KIRVVRKNIARVLTVINQTQKQELRKFYKGKKYLPTDLRYKKTRAMRRALTTHEASIKTA 97 Query: 90 KVRIHKQKFPALVFSVKA 37 K +KF F+VKA Sbjct: 98 KQLAKTRKFVTRKFAVKA 115 >gb|EKG19603.1| Ribosomal protein L29 [Macrophomina phaseolina MS6] Length = 125 Score = 77.0 bits (188), Expect = 5e-12 Identities = 42/78 (53%), Positives = 53/78 (67%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KI VRKSIARVLTVIN+ QREQLR FYKG+K +P L+ K++R R LT + S V Sbjct: 48 KIHDVRKSIARVLTVINKNQREQLRLFYKGKKYLPLDLRRKQTRAMRRRLTKHEASLVTE 107 Query: 90 KVRIHKQKFPALVFSVKA 37 K + + FP V++VKA Sbjct: 108 KQKKKQIHFPQRVYAVKA 125 >gb|ABW90366.1| putative ribosomal protein L35 [Sipunculus nudus] Length = 123 Score = 77.0 bits (188), Expect = 5e-12 Identities = 41/77 (53%), Positives = 53/77 (68%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK+IARVLTVINQTQ+E LR+FYKG+K PK L+ K++R R ALTP + S Sbjct: 46 KIRVVRKAIARVLTVINQTQKENLRKFYKGKKYKPKDLRYKKTRAMRKALTPYELSLKTA 105 Query: 90 KVRIHKQKFPALVFSVK 40 K + +P ++VK Sbjct: 106 KQMRKDRLYPMRKYAVK 122 >gb|ABK55652.1| RPL35 [Sus scrofa] Length = 123 Score = 77.0 bits (188), Expect = 5e-12 Identities = 40/78 (51%), Positives = 55/78 (70%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRKSIARVLTVINQTQ+E LR+FYKG+K P L+ K++R R L +++ P+ Sbjct: 46 KIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKPK 105 Query: 90 KVRIHKQKFPALVFSVKA 37 K + ++ +P F+VKA Sbjct: 106 KQQRKERLYPLRKFAVKA 123 >gb|KOO21433.1| 60s ribosomal protein l35 [Chrysochromulina sp. CCMP291] Length = 371 Score = 76.6 bits (187), Expect = 7e-12 Identities = 42/78 (53%), Positives = 54/78 (69%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KI+ VRKSIARVLTVINQTQ+ QLR FYK + +P L+ K++R R ALTP+QKS Sbjct: 294 KIKVVRKSIARVLTVINQTQKSQLRMFYKDKDLVPLDLRFKKTRAIRKALTPQQKSLKTL 353 Query: 90 KVRIHKQKFPALVFSVKA 37 K ++ FP ++VKA Sbjct: 354 KQAKKEKHFPIRKYAVKA 371 >gb|KKA71825.1| ribosomal protein [Pristionchus pacificus] Length = 123 Score = 76.6 bits (187), Expect = 7e-12 Identities = 40/78 (51%), Positives = 55/78 (70%) Frame = -3 Query: 270 KIRPVRKSIARVLTVINQTQREQLRRFYKGQKRMPKQLKVKESRKKRLALTPKQKSAVPR 91 KIR VRK+IARVLTVINQTQ+++LR+FYKG+K +P ++ K++R R ALT + S Sbjct: 46 KIRVVRKNIARVLTVINQTQKQELRKFYKGKKYLPTDIRYKKTRAMRRALTKHEASIKSA 105 Query: 90 KVRIHKQKFPALVFSVKA 37 K +KF + F+VKA Sbjct: 106 KQLAKTRKFVSRKFAVKA 123