BLASTX nr result
ID: Zanthoxylum22_contig00040997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00040997 (295 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446875.1| hypothetical protein CICLE_v10017662mg [Citr... 59 1e-06 >ref|XP_006446875.1| hypothetical protein CICLE_v10017662mg [Citrus clementina] gi|557549486|gb|ESR60115.1| hypothetical protein CICLE_v10017662mg [Citrus clementina] Length = 331 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 294 GTWGHSDGHVHSFGHEDTSPSCYPYGNYN*SSSWHGR 184 GTWG S GHVHSFGH +TSP+ + YG+Y SSSW GR Sbjct: 295 GTWGQSGGHVHSFGHGETSPNGHLYGDYCRSSSWSGR 331