BLASTX nr result
ID: Zanthoxylum22_contig00040653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00040653 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006374141.1| hypothetical protein POPTR_0015s02570g [Popu... 102 1e-19 gb|AEX57692.1| hypothetical protein RasatMp061 (mitochondrion) [... 74 3e-11 >ref|XP_006374141.1| hypothetical protein POPTR_0015s02570g [Populus trichocarpa] gi|550321813|gb|ERP51938.1| hypothetical protein POPTR_0015s02570g [Populus trichocarpa] Length = 70 Score = 102 bits (254), Expect = 1e-19 Identities = 49/63 (77%), Positives = 53/63 (84%) Frame = -2 Query: 307 SIHNRICKRFPVGRRPPSPGTDLYHSRRNEIKVLTFSLVSRSGVPSSLALRPRYSVSGFP 128 SI ICK FPV RR P+PG DLYH RRN+IK++TFSLVSRSGVPSSLALRPRYS S FP Sbjct: 6 SIQGCICKHFPVARRHPNPGIDLYHFRRNDIKLITFSLVSRSGVPSSLALRPRYSFSSFP 65 Query: 127 DFL 119 DFL Sbjct: 66 DFL 68 >gb|AEX57692.1| hypothetical protein RasatMp061 (mitochondrion) [Raphanus sativus] Length = 126 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 272 HGKTFADAIMNRTRSKHSAVDGQTLPKRRPQTEDG 376 HGKTFADAIMNRTRSKHSAVDGQTLPKRRPQT+DG Sbjct: 52 HGKTFADAIMNRTRSKHSAVDGQTLPKRRPQTKDG 86