BLASTX nr result
ID: Zanthoxylum22_contig00040609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00040609 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006426143.1| hypothetical protein CICLE_v10025041mg [Citr... 80 6e-13 gb|KDO78853.1| hypothetical protein CISIN_1g004733mg [Citrus sin... 79 2e-12 ref|XP_006466421.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_004144368.2| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_011653863.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 gb|KGN54739.1| hypothetical protein Csa_4G439060 [Cucumis sativus] 67 7e-09 ref|XP_008449654.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_008449638.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_008449604.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_010647149.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 emb|CBI41046.3| unnamed protein product [Vitis vinifera] 65 2e-08 emb|CAN71514.1| hypothetical protein VITISV_021786 [Vitis vinifera] 65 2e-08 ref|XP_007047614.1| Tetratricopeptide repeat (TPR)-like superfam... 64 4e-08 ref|XP_004289369.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_012437172.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_011073672.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_010547566.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_010106892.1| hypothetical protein L484_012985 [Morus nota... 61 4e-07 gb|KDP32117.1| hypothetical protein JCGZ_12578 [Jatropha curcas] 61 4e-07 ref|XP_009775967.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 >ref|XP_006426143.1| hypothetical protein CICLE_v10025041mg [Citrus clementina] gi|557528133|gb|ESR39383.1| hypothetical protein CICLE_v10025041mg [Citrus clementina] Length = 696 Score = 80.1 bits (196), Expect = 6e-13 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 318 KPSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 KPSVYVLLSNIYAAAGLWEEAAN+REL KRTGVMKQPG S IGS Sbjct: 653 KPSVYVLLSNIYAAAGLWEEAANIRELLKRTGVMKQPGCSWIGS 696 >gb|KDO78853.1| hypothetical protein CISIN_1g004733mg [Citrus sinensis] Length = 733 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 318 KPSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 KPSVYVLLSNIYAAAGLWEEAAN+REL KRTGV+KQPG S IGS Sbjct: 690 KPSVYVLLSNIYAAAGLWEEAANIRELLKRTGVIKQPGCSWIGS 733 >ref|XP_006466421.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like [Citrus sinensis] gi|568848690|ref|XP_006478131.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like [Citrus sinensis] Length = 733 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 318 KPSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 KPSVYVLLSNIYAAAGLWEEAAN+REL KRTGV+KQPG S IGS Sbjct: 690 KPSVYVLLSNIYAAAGLWEEAANIRELLKRTGVIKQPGCSWIGS 733 >ref|XP_004144368.2| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 isoform X2 [Cucumis sativus] Length = 735 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRI 193 PSVYV+LSNIYA+AG WEEAAN+REL K+TG MKQPG S I Sbjct: 694 PSVYVVLSNIYASAGCWEEAANVRELIKKTGSMKQPGCSWI 734 >ref|XP_011653863.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 isoform X1 [Cucumis sativus] Length = 735 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRI 193 PSVYV+LSNIYA+AG WEEAAN+REL K+TG MKQPG S I Sbjct: 694 PSVYVVLSNIYASAGCWEEAANVRELIKKTGSMKQPGCSWI 734 >gb|KGN54739.1| hypothetical protein Csa_4G439060 [Cucumis sativus] Length = 741 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRI 193 PSVYV+LSNIYA+AG WEEAAN+REL K+TG MKQPG S I Sbjct: 700 PSVYVVLSNIYASAGCWEEAANVRELIKKTGSMKQPGCSWI 740 >ref|XP_008449654.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 isoform X3 [Cucumis melo] Length = 735 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRI 193 PSVYV+LSNIYA+AG WEEAAN+REL K+TG MKQPG S I Sbjct: 694 PSVYVVLSNIYASAGCWEEAANVRELIKKTGSMKQPGCSWI 734 >ref|XP_008449638.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 isoform X2 [Cucumis melo] gi|659069406|ref|XP_008449646.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 isoform X2 [Cucumis melo] Length = 736 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRI 193 PSVYV+LSNIYA+AG WEEAAN+REL K+TG MKQPG S I Sbjct: 694 PSVYVVLSNIYASAGCWEEAANVRELIKKTGSMKQPGCSWI 734 >ref|XP_008449604.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 isoform X1 [Cucumis melo] gi|659069398|ref|XP_008449613.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 isoform X1 [Cucumis melo] gi|659069400|ref|XP_008449621.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 isoform X1 [Cucumis melo] gi|659069402|ref|XP_008449629.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 isoform X1 [Cucumis melo] Length = 740 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRI 193 PSVYV+LSNIYA+AG WEEAAN+REL K+TG MKQPG S I Sbjct: 694 PSVYVVLSNIYASAGCWEEAANVRELIKKTGSMKQPGCSWI 734 >ref|XP_010647149.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Vitis vinifera] gi|731441039|ref|XP_002263704.2| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Vitis vinifera] gi|731441041|ref|XP_010647150.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Vitis vinifera] gi|731441043|ref|XP_010647151.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Vitis vinifera] gi|731441045|ref|XP_010647153.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Vitis vinifera] Length = 735 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 P+VYVLLSNIYAAAG WEEAAN R+L ++T V KQPG S IGS Sbjct: 693 PAVYVLLSNIYAAAGQWEEAANTRDLMQKTRVAKQPGCSWIGS 735 >emb|CBI41046.3| unnamed protein product [Vitis vinifera] Length = 243 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 P+VYVLLSNIYAAAG WEEAAN R+L ++T V KQPG S IGS Sbjct: 201 PAVYVLLSNIYAAAGQWEEAANTRDLMQKTRVAKQPGCSWIGS 243 >emb|CAN71514.1| hypothetical protein VITISV_021786 [Vitis vinifera] Length = 690 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 P+VYVLLSNIYAAAG WEEAAN R+L ++T V KQPG S IGS Sbjct: 648 PAVYVLLSNIYAAAGQWEEAANTRDLMQKTRVAKQPGCSWIGS 690 >ref|XP_007047614.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590706055|ref|XP_007047615.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508699875|gb|EOX91771.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508699876|gb|EOX91772.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 738 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRI 193 PSVYVLLSNIYAAAG WEEAA +RE K GVMKQPG S I Sbjct: 696 PSVYVLLSNIYAAAGQWEEAARVRESMKNVGVMKQPGSSWI 736 >ref|XP_004289369.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Fragaria vesca subsp. vesca] Length = 733 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 PSVYVLL++IYAAAG WEEAAN+REL RTG +K PG S I S Sbjct: 691 PSVYVLLASIYAAAGQWEEAANVRELMNRTGEVKTPGCSWINS 733 >ref|XP_012437172.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Gossypium raimondii] Length = 758 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRI 193 PSVYVLLSN YAAAG WEEAA +RE K GVMKQPG S I Sbjct: 716 PSVYVLLSNTYAAAGQWEEAARVRESMKNVGVMKQPGSSWI 756 >ref|XP_011073672.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Sesamum indicum] gi|747054885|ref|XP_011073673.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Sesamum indicum] Length = 733 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 P+VYVLLSN+YA AG WEE+AN+REL K+ VMKQPG S I S Sbjct: 691 PAVYVLLSNLYANAGKWEESANLRELMKKYNVMKQPGSSWITS 733 >ref|XP_010547566.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Tarenaya hassleriana] Length = 735 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYS 199 PS+YVLLSNIYAAAG W+EA + RE K TG MKQPGYS Sbjct: 693 PSLYVLLSNIYAAAGQWKEAEDARESMKTTGAMKQPGYS 731 >ref|XP_010106892.1| hypothetical protein L484_012985 [Morus notabilis] gi|587925340|gb|EXC12608.1| hypothetical protein L484_012985 [Morus notabilis] Length = 737 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 PSVYVLL+NIYAAA W+EAA +REL +R G MKQPG S I S Sbjct: 691 PSVYVLLANIYAAADQWQEAATIRELMRRKGTMKQPGCSWITS 733 >gb|KDP32117.1| hypothetical protein JCGZ_12578 [Jatropha curcas] Length = 741 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -1 Query: 318 KPSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRI 193 KPSVYVLLSN+YAAAG WEEAA +R L T MKQ GYS I Sbjct: 698 KPSVYVLLSNMYAAAGQWEEAAKLRHLMDNTRAMKQTGYSWI 739 >ref|XP_009775967.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Nicotiana sylvestris] gi|698575559|ref|XP_009775968.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Nicotiana sylvestris] gi|698575562|ref|XP_009775969.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Nicotiana sylvestris] gi|698575566|ref|XP_009775970.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Nicotiana sylvestris] Length = 730 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -1 Query: 315 PSVYVLLSNIYAAAGLWEEAANMRELSKRTGVMKQPGYSRIGS 187 P+VYVLLSNIYA+A WE++AN+R+L + GV+KQPG S IGS Sbjct: 688 PTVYVLLSNIYASAENWEDSANVRKLMNKCGVLKQPGSSWIGS 730