BLASTX nr result
ID: Zanthoxylum22_contig00040408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00040408 (416 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006425824.1| hypothetical protein CICLE_v10026468mg [Citr... 66 9e-09 >ref|XP_006425824.1| hypothetical protein CICLE_v10026468mg [Citrus clementina] gi|568824716|ref|XP_006466742.1| PREDICTED: reticulon-like protein B13-like [Citrus sinensis] gi|557527814|gb|ESR39064.1| hypothetical protein CICLE_v10026468mg [Citrus clementina] Length = 214 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -3 Query: 414 IYQKYGDKIKSWGEEAKVKSRRFNEKVDEKIIKKLKSKVLT 292 IY+KYGDKIK GE AKVKSRRF E+VDEK+IKKLKSK +T Sbjct: 162 IYEKYGDKIKRCGETAKVKSRRFYEEVDEKVIKKLKSKFVT 202