BLASTX nr result
ID: Zanthoxylum22_contig00039372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039372 (366 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY17465.1| putative acyl binding family protein [Phaeomoniel... 64 3e-08 ref|XP_013344062.1| hypothetical protein AUEXF2481DRAFT_4656 [Au... 59 2e-06 ref|XP_013431921.1| acyl-CoA-binding protein [Aureobasidium nami... 59 2e-06 gb|KFY40177.1| hypothetical protein V495_05557 [Pseudogymnoascus... 58 2e-06 ref|XP_001240772.1| hypothetical protein CIMG_07935 [Coccidioide... 58 2e-06 ref|XP_003175512.1| hypothetical protein MGYG_03036 [Microsporum... 57 4e-06 gb|KEQ67597.1| acyl-CoA-binding protein [Aureobasidium melanogen... 57 5e-06 gb|EZF34142.1| hypothetical protein H101_02312 [Trichophyton int... 57 5e-06 gb|EGE00645.1| hypothetical protein TESG_07944 [Trichophyton ton... 57 5e-06 >gb|KKY17465.1| putative acyl binding family protein [Phaeomoniella chlamydospora] Length = 93 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = -2 Query: 143 MGSADFEEAVTASAKLKAKPSNEELLLLYAYFKQARQDPPIENAETP 3 M A F+ AV S KLKAKP+N+ELL LYA FKQA QDPPIE +ETP Sbjct: 1 MTGAAFKAAVEQSRKLKAKPTNDELLELYALFKQAEQDPPIEKSETP 47 >ref|XP_013344062.1| hypothetical protein AUEXF2481DRAFT_4656 [Aureobasidium subglaciale EXF-2481] gi|662538386|gb|KEQ95692.1| hypothetical protein AUEXF2481DRAFT_4656 [Aureobasidium subglaciale EXF-2481] Length = 95 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -2 Query: 137 SADFEEAVTASAKLKAKPSNEELLLLYAYFKQARQDPPIENAETP 3 +A+F++AV S KLKAKPS++ELL LY FKQ QDPPIE+++ P Sbjct: 5 TAEFKKAVEDSRKLKAKPSDDELLQLYGLFKQGTQDPPIESSDKP 49 >ref|XP_013431921.1| acyl-CoA-binding protein [Aureobasidium namibiae CBS 147.97] gi|662520415|gb|KEQ77973.1| acyl-CoA-binding protein [Aureobasidium namibiae CBS 147.97] gi|662524089|gb|KEQ81478.1| acyl-CoA-binding protein [Aureobasidium pullulans EXF-150] Length = 95 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -2 Query: 137 SADFEEAVTASAKLKAKPSNEELLLLYAYFKQARQDPPIENAETP 3 +A+F++AV S KLKAKPS++ELL LY FKQ QDPPIE+++ P Sbjct: 5 TAEFKKAVEDSRKLKAKPSDDELLQLYGLFKQGTQDPPIESSDKP 49 >gb|KFY40177.1| hypothetical protein V495_05557 [Pseudogymnoascus pannorum VKM F-4514 (FW-929)] gi|682369467|gb|KFY55077.1| hypothetical protein V497_07192 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] Length = 105 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -2 Query: 137 SADFEEAVTASAKLKAKPSNEELLLLYAYFKQARQDPPIENAETP 3 S FE+AV S KL AKPSN++LL +Y FKQA QDPPI+ AE P Sbjct: 5 SPAFEQAVVDSKKLVAKPSNDDLLEMYGLFKQATQDPPIDKAEAP 49 >ref|XP_001240772.1| hypothetical protein CIMG_07935 [Coccidioides immitis RS] gi|303310199|ref|XP_003065112.1| Acyl CoA binding family protein [Coccidioides posadasii C735 delta SOWgp] gi|90299558|gb|EAS29189.1| hypothetical protein CIMG_07935 [Coccidioides immitis RS] gi|240104772|gb|EER22967.1| Acyl CoA binding family protein [Coccidioides posadasii C735 delta SOWgp] gi|320034011|gb|EFW15957.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|855534356|gb|KMM69269.1| hypothetical protein CPAG_05589 [Coccidioides posadasii RMSCC 3488] gi|859412265|gb|KMP06309.1| hypothetical protein CIRG_05990 [Coccidioides immitis RMSCC 2394] gi|875286860|gb|KMU80489.1| hypothetical protein CISG_02340 [Coccidioides immitis RMSCC 3703] Length = 104 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = -2 Query: 146 TMGSADFEEAVTASAKLKAKPSNEELLLLYAYFKQARQDPPIENAETP 3 T + +FE AV AS KL AKP+++ELL+LYA FKQ QDPP E A P Sbjct: 2 TAKTPEFEAAVEASRKLLAKPTDDELLMLYALFKQGMQDPPFETAPVP 49 >ref|XP_003175512.1| hypothetical protein MGYG_03036 [Microsporum gypseum CBS 118893] gi|311340827|gb|EFR00030.1| hypothetical protein MGYG_03036 [Microsporum gypseum CBS 118893] Length = 118 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = -2 Query: 143 MGSADFEEAVTASAKLKAKPSNEELLLLYAYFKQARQDPPIENAETP 3 M DF+ A AS +L AKPSN+ELL LYA +KQ QDPP E A +P Sbjct: 1 MSDTDFKAAAEASRRLLAKPSNDELLKLYALYKQGTQDPPFEKAPSP 47 >gb|KEQ67597.1| acyl-CoA-binding protein [Aureobasidium melanogenum CBS 110374] Length = 95 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -2 Query: 137 SADFEEAVTASAKLKAKPSNEELLLLYAYFKQARQDPPIENAETP 3 +A+F++AV S KL+AKPS++ELL LY FKQ QDPPIE+++ P Sbjct: 5 TAEFKKAVEDSRKLQAKPSDDELLQLYGLFKQGTQDPPIESSDKP 49 >gb|EZF34142.1| hypothetical protein H101_02312 [Trichophyton interdigitale H6] gi|633049423|gb|KDB25603.1| hypothetical protein H109_02564 [Trichophyton interdigitale MR816] Length = 103 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = -2 Query: 143 MGSADFEEAVTASAKLKAKPSNEELLLLYAYFKQARQDPPIENAETP 3 M S +F A AS KL AKPS++ELL LYA FKQ +QDPP E A P Sbjct: 1 MSSPEFLAAAEASRKLLAKPSDDELLTLYALFKQGKQDPPFEQAPAP 47 >gb|EGE00645.1| hypothetical protein TESG_07944 [Trichophyton tonsurans CBS 112818] gi|326478090|gb|EGE02100.1| hypothetical protein TEQG_01139 [Trichophyton equinum CBS 127.97] Length = 103 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = -2 Query: 143 MGSADFEEAVTASAKLKAKPSNEELLLLYAYFKQARQDPPIENAETP 3 M S +F A AS KL AKPS++ELL LYA FKQ +QDPP E A P Sbjct: 1 MSSLEFLAAAEASRKLLAKPSDDELLTLYALFKQGKQDPPFEQAPAP 47