BLASTX nr result
ID: Zanthoxylum22_contig00037448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00037448 (276 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432661.1| hypothetical protein CICLE_v10003017mg [Citr... 97 5e-18 >ref|XP_006432661.1| hypothetical protein CICLE_v10003017mg [Citrus clementina] gi|557534783|gb|ESR45901.1| hypothetical protein CICLE_v10003017mg [Citrus clementina] Length = 80 Score = 97.1 bits (240), Expect = 5e-18 Identities = 56/82 (68%), Positives = 59/82 (71%), Gaps = 2/82 (2%) Frame = +1 Query: 28 MKAL-YTFLAPLIFLIFISS-TVHHSEXXXXXXXXXXXXXGFNHVWQRKPRINHGSFRGP 201 MKAL Y FLA LI LI ISS TVHHSE G NHVWQ KP++NHGSFRGP Sbjct: 1 MKALFYPFLA-LISLILISSITVHHSEAAAAVVGVRAVA-GANHVWQHKPQMNHGSFRGP 58 Query: 202 RKHLVDPTATEDHLFEVPKLPV 267 RKHLVDPTA E+H FEVPKLPV Sbjct: 59 RKHLVDPTAAEEHPFEVPKLPV 80