BLASTX nr result
ID: Zanthoxylum22_contig00036842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00036842 (623 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KGN58259.1| hypothetical protein Csa_3G600000 [Cucumis sativus] 57 6e-06 >gb|KGN58259.1| hypothetical protein Csa_3G600000 [Cucumis sativus] Length = 61 Score = 57.4 bits (137), Expect = 6e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +1 Query: 496 RGYLSFGTKEFELGLVNWNVYYPYRGSSN*EDPST 600 R + FGTK+ ELG +NWNVYYPYRGS N EDPST Sbjct: 27 RPVVCFGTKQLELGSLNWNVYYPYRGSFNGEDPST 61