BLASTX nr result
ID: Zanthoxylum22_contig00036584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00036584 (279 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447328.1| hypothetical protein CICLE_v10017627mg [Citr... 58 3e-06 >ref|XP_006447328.1| hypothetical protein CICLE_v10017627mg [Citrus clementina] gi|557549939|gb|ESR60568.1| hypothetical protein CICLE_v10017627mg [Citrus clementina] Length = 62 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -2 Query: 137 IFRFC*LFVPLSISCIFMLHHSQDCRLLIAPFAQQFLNS 21 +F FC LF PL +S IFMLHHSQDCR LI PF QQ+ S Sbjct: 1 MFCFCRLFFPLYVSGIFMLHHSQDCRFLIPPFTQQYFKS 39