BLASTX nr result
ID: Zanthoxylum22_contig00036576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00036576 (499 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009166146.1| ribosomal protein L33 (chloroplast) [Zanthox... 142 1e-31 ref|YP_740496.1| ribosomal protein L33 (chloroplast) [Citrus sin... 140 4e-31 ref|XP_006435533.1| hypothetical protein CICLE_v10033989mg [Citr... 139 1e-30 ref|YP_008577683.1| ribosomal protein L33 (chloroplast) [Corymbi... 138 1e-30 ref|YP_001294205.1| ribosomal protein L33 [Buxus microphylla] gi... 138 1e-30 ref|YP_784407.1| ribosomal protein L33 [Drimys granadensis] gi|1... 137 4e-30 gb|ADD30179.1| ribosomal protein L33 (chloroplast) [Meliosma aff... 136 7e-30 ref|YP_009019909.1| ribosomal protein L33 (chloroplast) [Azadira... 136 7e-30 ref|YP_008576068.1| ribosomal protein L33 (chloroplast) [Eucalyp... 136 7e-30 ref|YP_004563888.1| ribosomal protein L33 [Nelumbo lutea] gi|700... 135 9e-30 ref|YP_008578108.1| ribosomal protein L33 (chloroplast) [Allosyn... 135 9e-30 ref|YP_001542468.1| ribosomal protein L33 [Ceratophyllum demersu... 135 9e-30 gb|AHF71528.1| 50S ribosomal protein L33 (chloroplast) [Acer bue... 134 2e-29 ref|YP_001671704.1| ribosomal protein L33 [Carica papaya] gi|218... 134 2e-29 gb|ADD30189.1| ribosomal protein L33 (chloroplast) [Heuchera san... 134 3e-29 ref|YP_008577343.1| ribosomal protein L33 (chloroplast) [Eucalyp... 134 3e-29 ref|YP_002836111.1| ribosomal protein L33 [Megaleranthis sanicul... 134 3e-29 gb|AIS35704.1| ribosomal protein L33 (chloroplast) [Mesembryanth... 134 3e-29 ref|YP_009114890.1| ribosomal protein L33 [Thalictrum coreanum] ... 134 3e-29 ref|YP_636319.1| ribosomal protein L33 (chloroplast) [Eucalyptus... 134 3e-29 >ref|YP_009166146.1| ribosomal protein L33 (chloroplast) [Zanthoxylum piperitum] gi|918056446|gb|AKZ89343.1| ribosomal protein L33 (chloroplast) [Zanthoxylum piperitum] Length = 66 Score = 142 bits (357), Expect = 1e-31 Identities = 66/66 (100%), Positives = 66/66 (100%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL Sbjct: 1 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_740496.1| ribosomal protein L33 (chloroplast) [Citrus sinensis] gi|697964782|ref|YP_009059370.1| ribosomal protein L33 (chloroplast) [Citrus aurantiifolia] gi|122166162|sp|Q09MF7.1|RK33_CITSI RecName: Full=50S ribosomal protein L33, chloroplastic gi|113952643|gb|ABI49041.1| ribosomal protein L33 (chloroplast) [Citrus sinensis] gi|675269915|gb|AIL50306.1| ribosomal protein L33 (chloroplast) [Citrus aurantiifolia] Length = 66 Score = 140 bits (353), Expect = 4e-31 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGK+VRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL Sbjct: 1 MAKGKEVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|XP_006435533.1| hypothetical protein CICLE_v10033989mg [Citrus clementina] gi|557537729|gb|ESR48773.1| hypothetical protein CICLE_v10033989mg [Citrus clementina] Length = 66 Score = 139 bits (349), Expect = 1e-30 Identities = 64/66 (96%), Positives = 66/66 (100%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGK+VRVRVILECTSCV+NGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL Sbjct: 1 MAKGKEVRVRVILECTSCVQNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_008577683.1| ribosomal protein L33 (chloroplast) [Corymbia maculata] gi|545718931|ref|YP_008577768.1| ribosomal protein L33 (chloroplast) [Corymbia eximia] gi|442568925|gb|AGC59092.1| ribosomal protein L33 (chloroplast) [Corymbia maculata] gi|442569011|gb|AGC59177.1| ribosomal protein L33 (chloroplast) [Corymbia eximia] Length = 66 Score = 138 bits (348), Expect = 1e-30 Identities = 62/66 (93%), Positives = 66/66 (100%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRVRVILECT+CVRNG+NKESRG+SRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKGKDVRVRVILECTNCVRNGLNKESRGVSRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_001294205.1| ribosomal protein L33 [Buxus microphylla] gi|218546837|sp|A6MM57.1|RK33_BUXMI RecName: Full=50S ribosomal protein L33, chloroplastic gi|146762306|gb|ABQ45270.1| ribosomal protein L33 [Buxus microphylla] Length = 66 Score = 138 bits (348), Expect = 1e-30 Identities = 64/66 (96%), Positives = 65/66 (98%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRVRVILECTSCVRNGVNKES GISRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKGKDVRVRVILECTSCVRNGVNKESLGISRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_784407.1| ribosomal protein L33 [Drimys granadensis] gi|122164420|sp|Q06GX6.1|RK33_DRIGR RecName: Full=50S ribosomal protein L33, chloroplastic gi|112032683|gb|ABH88318.1| ribosomal protein L33 (chloroplast) [Drimys granadensis] Length = 66 Score = 137 bits (344), Expect = 4e-30 Identities = 62/66 (93%), Positives = 65/66 (98%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVR+RVILECTSCVRN +NKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKGKDVRIRVILECTSCVRNDLNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >gb|ADD30179.1| ribosomal protein L33 (chloroplast) [Meliosma aff. cuneifolia Moore 333] Length = 66 Score = 136 bits (342), Expect = 7e-30 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRV VILECTSCVRNGVNKES GISRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKGKDVRVTVILECTSCVRNGVNKESPGISRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_009019909.1| ribosomal protein L33 (chloroplast) [Azadirachta indica] gi|586947556|gb|AHJ91339.1| ribosomal protein L33 (chloroplast) [Azadirachta indica] Length = 66 Score = 136 bits (342), Expect = 7e-30 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRVRVILECTSCVRN VNKESRGISRYITQKNRHNTPSRLELRKFCPYCY HT+ Sbjct: 1 MAKGKDVRVRVILECTSCVRNDVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYTHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_008576068.1| ribosomal protein L33 (chloroplast) [Eucalyptus patens] gi|545717297|ref|YP_008576153.1| ribosomal protein L33 (chloroplast) [Eucalyptus marginata] gi|545717383|ref|YP_008576238.1| ribosomal protein L33 (chloroplast) [Eucalyptus curtisii] gi|545717469|ref|YP_008576323.1| ribosomal protein L33 (chloroplast) [Eucalyptus melliodora] gi|545717555|ref|YP_008576408.1| ribosomal protein L33 (chloroplast) [Eucalyptus polybractea] gi|545717641|ref|YP_008576493.1| ribosomal protein L33 (chloroplast) [Eucalyptus cladocalyx] gi|545718071|ref|YP_008576918.1| ribosomal protein L33 (chloroplast) [Eucalyptus deglupta] gi|545718157|ref|YP_008577003.1| ribosomal protein L33 (chloroplast) [Eucalyptus spathulata] gi|545718243|ref|YP_008577088.1| ribosomal protein L33 (chloroplast) [Eucalyptus torquata] gi|545718329|ref|YP_008577173.1| ribosomal protein L33 (chloroplast) [Eucalyptus diversicolor] gi|545718415|ref|YP_008577258.1| ribosomal protein L33 (chloroplast) [Eucalyptus salmonophloia] gi|545718587|ref|YP_008577428.1| ribosomal protein L33 (chloroplast) [Eucalyptus guilfoylei] gi|545718673|ref|YP_008577513.1| ribosomal protein L33 (chloroplast) [Eucalyptus erythrocorys] gi|545718759|ref|YP_008577598.1| ribosomal protein L33 (chloroplast) [Corymbia gummifera] gi|545719017|ref|YP_008577853.1| ribosomal protein L33 (chloroplast) [Corymbia tessellaris] gi|545719103|ref|YP_008577938.1| ribosomal protein L33 (chloroplast) [Angophora floribunda] gi|545719189|ref|YP_008578023.1| ribosomal protein L33 (chloroplast) [Angophora costata] gi|953244327|ref|YP_009179528.1| ribosomal protein L33 (chloroplast) [Corymbia henryi] gi|953244413|ref|YP_009179613.1| ribosomal protein L33 (chloroplast) [Corymbia torelliana] gi|442567119|gb|AGC57307.1| ribosomal protein L33 (chloroplast) [Eucalyptus patens] gi|442567205|gb|AGC57392.1| ribosomal protein L33 (chloroplast) [Eucalyptus marginata] gi|442567291|gb|AGC57477.1| ribosomal protein L33 (chloroplast) [Eucalyptus curtisii] gi|442567377|gb|AGC57562.1| ribosomal protein L33 (chloroplast) [Eucalyptus melliodora] gi|442567463|gb|AGC57647.1| ribosomal protein L33 (chloroplast) [Eucalyptus melliodora] gi|442567549|gb|AGC57732.1| ribosomal protein L33 (chloroplast) [Eucalyptus polybractea] gi|442567635|gb|AGC57817.1| ribosomal protein L33 (chloroplast) [Eucalyptus cladocalyx] gi|442568151|gb|AGC58327.1| ribosomal protein L33 (chloroplast) [Eucalyptus deglupta] gi|442568237|gb|AGC58412.1| ribosomal protein L33 (chloroplast) [Eucalyptus spathulata] gi|442568323|gb|AGC58497.1| ribosomal protein L33 (chloroplast) [Eucalyptus torquata] gi|442568409|gb|AGC58582.1| ribosomal protein L33 (chloroplast) [Eucalyptus diversicolor] gi|442568495|gb|AGC58667.1| ribosomal protein L33 (chloroplast) [Eucalyptus salmonophloia] gi|442568667|gb|AGC58837.1| ribosomal protein L33 (chloroplast) [Eucalyptus guilfoylei] gi|442568753|gb|AGC58922.1| ribosomal protein L33 (chloroplast) [Eucalyptus erythrocorys] gi|442568839|gb|AGC59007.1| ribosomal protein L33 (chloroplast) [Corymbia gummifera] gi|442569097|gb|AGC59262.1| ribosomal protein L33 (chloroplast) [Corymbia tessellaris] gi|442569183|gb|AGC59347.1| ribosomal protein L33 (chloroplast) [Angophora floribunda] gi|442569269|gb|AGC59432.1| ribosomal protein L33 (chloroplast) [Angophora costata] gi|782493156|gb|AJZ71615.1| ribosomal protein L33 (chloroplast) [Corymbia citriodora subsp. variegata] gi|808177155|gb|AKC98524.1| ribosomal protein L33 (chloroplast) [Corymbia citriodora subsp. citriodora] gi|808177241|gb|AKC98609.1| ribosomal protein L33 (chloroplast) [Corymbia citriodora subsp. variegata] gi|808177327|gb|AKC98694.1| ribosomal protein L33 (chloroplast) [Corymbia citriodora subsp. variegata] gi|808177412|gb|AKC98778.1| ribosomal protein L33 (chloroplast) [Corymbia henryi] gi|808177498|gb|AKC98863.1| ribosomal protein L33 (chloroplast) [Corymbia torelliana] gi|808177583|gb|AKC98947.1| ribosomal protein L33 (chloroplast) [Corymbia torelliana] gi|808177668|gb|AKC99031.1| ribosomal protein L33 (chloroplast) [Corymbia torelliana] gi|808177753|gb|AKC99115.1| ribosomal protein L33 (chloroplast) [Corymbia torelliana] Length = 66 Score = 136 bits (342), Expect = 7e-30 Identities = 61/66 (92%), Positives = 65/66 (98%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRV VILECT+CVRNG+NKESRG+SRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKGKDVRVTVILECTNCVRNGLNKESRGVSRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_004563888.1| ribosomal protein L33 [Nelumbo lutea] gi|700491251|ref|YP_009093971.1| ribosomal protein L33 (chloroplast) [Nelumbo nucifera] gi|224474155|gb|ACN49344.1| ribosomal protein L33 (chloroplast) [Nelumbo lutea] gi|224474243|gb|ACN49429.1| ribosomal protein L33 (chloroplast) [Nelumbo nucifera] gi|290487592|gb|ADD30180.1| ribosomal protein L33 (chloroplast) [Nelumbo nucifera] gi|383286818|gb|AFH01468.1| ribosomal protein L33 (chloroplast) [Nelumbo nucifera] gi|383286913|gb|AFH01562.1| ribosomal protein L33 (chloroplast) [Nelumbo lutea] gi|519666933|gb|AGO98545.1| ribosomal protein L33 (chloroplast) [Nelumbo nucifera] gi|725824064|gb|AIY33843.1| ribosomal protein L33 (chloroplast) [Nelumbo nucifera] Length = 66 Score = 135 bits (341), Expect = 9e-30 Identities = 62/66 (93%), Positives = 65/66 (98%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRVRVILECT+CVRNGVNKES GISRYITQKNRHNTPSRLELRKFCPYC+KHT+ Sbjct: 1 MAKGKDVRVRVILECTNCVRNGVNKESPGISRYITQKNRHNTPSRLELRKFCPYCFKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_008578108.1| ribosomal protein L33 (chloroplast) [Allosyncarpia ternata] gi|442569355|gb|AGC59517.1| ribosomal protein L33 (chloroplast) [Allosyncarpia ternata] Length = 66 Score = 135 bits (341), Expect = 9e-30 Identities = 61/66 (92%), Positives = 65/66 (98%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRV VILECT+CVRNG+NKESRG+SRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKGKDVRVTVILECTNCVRNGLNKESRGLSRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_001542468.1| ribosomal protein L33 [Ceratophyllum demersum] gi|218546840|sp|A8SEC4.1|RK33_CERDE RecName: Full=50S ribosomal protein L33, chloroplastic gi|148508464|gb|ABQ81471.1| ribosomal protein L33 (chloroplast) [Ceratophyllum demersum] Length = 66 Score = 135 bits (341), Expect = 9e-30 Identities = 63/66 (95%), Positives = 63/66 (95%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRVRVILECTSC RNG NKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHT Sbjct: 1 MAKGKDVRVRVILECTSCARNGGNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTT 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >gb|AHF71528.1| 50S ribosomal protein L33 (chloroplast) [Acer buergerianum subsp. ningpoense] Length = 66 Score = 134 bits (338), Expect = 2e-29 Identities = 61/66 (92%), Positives = 64/66 (96%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRVRVILECT CVRNG+NKES GISRYITQKNRHNTPSRLELRKFCPYC+KHT+ Sbjct: 1 MAKGKDVRVRVILECTGCVRNGLNKESTGISRYITQKNRHNTPSRLELRKFCPYCFKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_001671704.1| ribosomal protein L33 [Carica papaya] gi|218546839|sp|B1A956.1|RK33_CARPA RecName: Full=50S ribosomal protein L33, chloroplastic gi|166344153|gb|ABY86803.1| ribosomal protein L33 (chloroplast) [Carica papaya] Length = 66 Score = 134 bits (338), Expect = 2e-29 Identities = 61/66 (92%), Positives = 63/66 (95%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKD RV +ILECTSCVRNGVNKES GISRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKGKDARVTIILECTSCVRNGVNKESTGISRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >gb|ADD30189.1| ribosomal protein L33 (chloroplast) [Heuchera sanguinea] gi|924443871|gb|ALB78401.1| ribosomal protein L33 (chloroplast) [Heuchera parviflora var. saurensis] Length = 66 Score = 134 bits (337), Expect = 3e-29 Identities = 62/66 (93%), Positives = 63/66 (95%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAK KDVRV VILECTSCVRNGVNKES GISRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKSKDVRVTVILECTSCVRNGVNKESMGISRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_008577343.1| ribosomal protein L33 (chloroplast) [Eucalyptus microcorys] gi|442568581|gb|AGC58752.1| ribosomal protein L33 (chloroplast) [Eucalyptus microcorys] Length = 66 Score = 134 bits (337), Expect = 3e-29 Identities = 60/66 (90%), Positives = 64/66 (96%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRV VILECT+CVRNG+NKESRG+SRYITQKNRHNTPSRLELRKFCPYCY HT+ Sbjct: 1 MAKGKDVRVTVILECTNCVRNGLNKESRGVSRYITQKNRHNTPSRLELRKFCPYCYNHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_002836111.1| ribosomal protein L33 [Megaleranthis saniculifolia] gi|226933903|gb|ACO92036.1| ribosomal protein L33 (chloroplast) [Megaleranthis saniculifolia] Length = 66 Score = 134 bits (337), Expect = 3e-29 Identities = 61/66 (92%), Positives = 64/66 (96%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRVRVILEC SCVRN +NKESRGISRYITQKNRHNTPSRLELRKFCP+CYKHT+ Sbjct: 1 MAKGKDVRVRVILECNSCVRNDINKESRGISRYITQKNRHNTPSRLELRKFCPHCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >gb|AIS35704.1| ribosomal protein L33 (chloroplast) [Mesembryanthemum crystallinum] Length = 66 Score = 134 bits (336), Expect = 3e-29 Identities = 61/66 (92%), Positives = 63/66 (95%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRV+VILECT CVR VNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKGKDVRVKVILECTGCVRKSVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_009114890.1| ribosomal protein L33 [Thalictrum coreanum] gi|721136326|gb|AIX03537.1| ribosomal protein L33 (plastid) [Thalictrum coreanum] Length = 68 Score = 134 bits (336), Expect = 3e-29 Identities = 63/68 (92%), Positives = 65/68 (95%), Gaps = 2/68 (2%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVN--KESRGISRYITQKNRHNTPSRLELRKFCPYCYKH 327 MAKGKDVRVRVILEC SCVRNG+N KESRGISRYITQKNRHNTPSRLELRKFCPYCYKH Sbjct: 1 MAKGKDVRVRVILECNSCVRNGININKESRGISRYITQKNRHNTPSRLELRKFCPYCYKH 60 Query: 328 TLHGEIKK 351 T+HGEIKK Sbjct: 61 TIHGEIKK 68 >ref|YP_636319.1| ribosomal protein L33 (chloroplast) [Eucalyptus globulus subsp. globulus] gi|309322467|ref|YP_003933980.1| ribosomal protein L33 (chloroplast) [Eucalyptus grandis] gi|545717727|ref|YP_008576578.1| ribosomal protein L33 (chloroplast) [Eucalyptus nitens] gi|545717813|ref|YP_008576663.1| ribosomal protein L33 (chloroplast) [Eucalyptus aromaphloia] gi|545717899|ref|YP_008576748.1| ribosomal protein L33 (chloroplast) [Eucalyptus saligna] gi|545717985|ref|YP_008576833.1| ribosomal protein L33 (chloroplast) [Eucalyptus camaldulensis] gi|122219172|sp|Q49KX8.1|RK33_EUCGG RecName: Full=50S ribosomal protein L33, chloroplastic gi|60460829|gb|AAX21049.1| ribosomal protein L33 (chloroplast) [Eucalyptus globulus subsp. globulus] gi|296936692|gb|ADH94364.1| ribosomal protein L33 (chloroplast) [Syzygium cumini] gi|308223301|gb|ADO23609.1| ribosomal protein L33 (chloroplast) [Eucalyptus grandis] gi|442567721|gb|AGC57902.1| ribosomal protein L33 (chloroplast) [Eucalyptus globulus] gi|442567807|gb|AGC57987.1| ribosomal protein L33 (chloroplast) [Eucalyptus nitens] gi|442567893|gb|AGC58072.1| ribosomal protein L33 (chloroplast) [Eucalyptus aromaphloia] gi|442567979|gb|AGC58157.1| ribosomal protein L33 (chloroplast) [Eucalyptus saligna] gi|442568065|gb|AGC58242.1| ribosomal protein L33 (chloroplast) [Eucalyptus camaldulensis] Length = 66 Score = 134 bits (336), Expect = 3e-29 Identities = 60/66 (90%), Positives = 64/66 (96%) Frame = +1 Query: 154 MAKGKDVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 333 MAKGKDVRV VILECT+CVR G+NKESRG+SRYITQKNRHNTPSRLELRKFCPYCYKHT+ Sbjct: 1 MAKGKDVRVTVILECTNCVRTGLNKESRGVSRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 334 HGEIKK 351 HGEIKK Sbjct: 61 HGEIKK 66