BLASTX nr result
ID: Zanthoxylum22_contig00033898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00033898 (471 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO81177.1| hypothetical protein CISIN_1g009063mg [Citrus sin... 60 5e-07 ref|XP_006472464.1| PREDICTED: mechanosensitive ion channel prot... 60 5e-07 gb|KDO81175.1| hypothetical protein CISIN_1g009063mg [Citrus sin... 57 5e-06 ref|XP_006472467.1| PREDICTED: mechanosensitive ion channel prot... 57 5e-06 >gb|KDO81177.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis] Length = 545 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 104 MTCSSTMQLSQELKIYNKFGCSTLHSGVTGKGRL 3 MTCSSTMQLSQEL IYNKFGCS L++ TGKGRL Sbjct: 1 MTCSSTMQLSQELNIYNKFGCSNLYTRQTGKGRL 34 >ref|XP_006472464.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like isoform X1 [Citrus sinensis] gi|568836889|ref|XP_006472465.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like isoform X2 [Citrus sinensis] gi|568836891|ref|XP_006472466.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like isoform X3 [Citrus sinensis] Length = 699 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 104 MTCSSTMQLSQELKIYNKFGCSTLHSGVTGKGRL 3 MTCSSTMQLSQEL IYNKFGCS L++ TGKGRL Sbjct: 1 MTCSSTMQLSQELNIYNKFGCSNLYTRQTGKGRL 34 >gb|KDO81175.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis] gi|641862489|gb|KDO81176.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis] Length = 543 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 104 MTCSSTMQLSQELKIYNKFGCSTLHSGVTGKGRL 3 MTCSSTMQLSQEL IYNKFGCS L++ TGKGRL Sbjct: 1 MTCSSTMQLSQELNIYNKFGCSNLYT--TGKGRL 32 >ref|XP_006472467.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like isoform X4 [Citrus sinensis] Length = 697 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 104 MTCSSTMQLSQELKIYNKFGCSTLHSGVTGKGRL 3 MTCSSTMQLSQEL IYNKFGCS L++ TGKGRL Sbjct: 1 MTCSSTMQLSQELNIYNKFGCSNLYT--TGKGRL 32