BLASTX nr result
ID: Zanthoxylum22_contig00033429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00033429 (406 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05881.1| unnamed protein product [Coffea canephora] 59 2e-06 ref|XP_002532018.1| conserved hypothetical protein [Ricinus comm... 56 9e-06 >emb|CDP05881.1| unnamed protein product [Coffea canephora] Length = 62 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/62 (50%), Positives = 37/62 (59%) Frame = -1 Query: 247 MGLGVEIIMAVXXXXXXXXXXXLIRYAGEMAEVMGYATRRILRGMPSFIFSTYLPYSFHF 68 M LG EI+MAV +R+A EM EV+G A RI RG PS+ S+YLPYS F Sbjct: 1 MSLGAEIVMAVVGLWATSLRPLTMRFAAEMVEVLGRAIYRICRGNPSYSPSSYLPYSTSF 60 Query: 67 LY 62 LY Sbjct: 61 LY 62 >ref|XP_002532018.1| conserved hypothetical protein [Ricinus communis] gi|223528313|gb|EEF30357.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/61 (50%), Positives = 34/61 (55%) Frame = -1 Query: 247 MGLGVEIIMAVXXXXXXXXXXXLIRYAGEMAEVMGYATRRILRGMPSFIFSTYLPYSFHF 68 M G EI MAV ++R+AGEM EVMG A RI RG PS S YLPYS F Sbjct: 1 MSTGAEIAMAVVGLWAVTLRPLVMRFAGEMVEVMGCAMLRIFRGSPSSAISAYLPYSSSF 60 Query: 67 L 65 L Sbjct: 61 L 61