BLASTX nr result
ID: Zanthoxylum22_contig00033090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00033090 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009359090.1| PREDICTED: probable monogalactosyldiacylglyc... 97 5e-18 ref|XP_008379349.1| PREDICTED: probable monogalactosyldiacylglyc... 97 5e-18 ref|XP_008220644.1| PREDICTED: monogalactosyldiacylglycerol synt... 97 5e-18 gb|KDO67395.1| hypothetical protein CISIN_1g036427mg [Citrus sin... 97 5e-18 emb|CBI21162.3| unnamed protein product [Vitis vinifera] 97 5e-18 ref|XP_006450252.1| hypothetical protein CICLE_v10007936mg [Citr... 97 5e-18 ref|XP_006450251.1| hypothetical protein CICLE_v10007936mg [Citr... 97 5e-18 ref|XP_006450250.1| hypothetical protein CICLE_v10007936mg [Citr... 97 5e-18 ref|XP_004293248.1| PREDICTED: monogalactosyldiacylglycerol synt... 97 5e-18 ref|XP_007222305.1| hypothetical protein PRUPE_ppa003927mg [Prun... 97 5e-18 ref|XP_002283410.2| PREDICTED: monogalactosyldiacylglycerol synt... 97 5e-18 emb|CAN84152.1| hypothetical protein VITISV_023773 [Vitis vinifera] 97 5e-18 ref|XP_010095402.1| putative monogalactosyldiacylglycerol syntha... 96 1e-17 ref|XP_009363377.1| PREDICTED: probable monogalactosyldiacylglyc... 96 1e-17 ref|XP_002515397.1| 1,2-diacylglycerol 3-beta-galactosyltransfer... 95 2e-17 ref|XP_007161099.1| hypothetical protein PHAVU_001G042600g [Phas... 95 2e-17 ref|XP_010670850.1| PREDICTED: monogalactosyldiacylglycerol synt... 94 3e-17 ref|XP_014502519.1| PREDICTED: probable monogalactosyldiacylglyc... 94 4e-17 ref|XP_014502518.1| PREDICTED: probable monogalactosyldiacylglyc... 94 4e-17 gb|KOM48781.1| hypothetical protein LR48_Vigan07g248500 [Vigna a... 94 4e-17 >ref|XP_009359090.1| PREDICTED: probable monogalactosyldiacylglycerol synthase, chloroplastic [Pyrus x bretschneideri] gi|694356946|ref|XP_009359145.1| PREDICTED: probable monogalactosyldiacylglycerol synthase, chloroplastic [Pyrus x bretschneideri] Length = 541 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 184 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 225 >ref|XP_008379349.1| PREDICTED: probable monogalactosyldiacylglycerol synthase, chloroplastic [Malus domestica] Length = 541 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 184 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 225 >ref|XP_008220644.1| PREDICTED: monogalactosyldiacylglycerol synthase, chloroplastic [Prunus mume] Length = 539 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 181 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 222 >gb|KDO67395.1| hypothetical protein CISIN_1g036427mg [Citrus sinensis] Length = 536 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 178 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 219 >emb|CBI21162.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 28 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 69 >ref|XP_006450252.1| hypothetical protein CICLE_v10007936mg [Citrus clementina] gi|568860010|ref|XP_006483521.1| PREDICTED: monogalactosyldiacylglycerol synthase, chloroplastic-like [Citrus sinensis] gi|557553478|gb|ESR63492.1| hypothetical protein CICLE_v10007936mg [Citrus clementina] Length = 536 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 178 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 219 >ref|XP_006450251.1| hypothetical protein CICLE_v10007936mg [Citrus clementina] gi|557553477|gb|ESR63491.1| hypothetical protein CICLE_v10007936mg [Citrus clementina] Length = 500 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 178 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 219 >ref|XP_006450250.1| hypothetical protein CICLE_v10007936mg [Citrus clementina] gi|557553476|gb|ESR63490.1| hypothetical protein CICLE_v10007936mg [Citrus clementina] Length = 542 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 178 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 219 >ref|XP_004293248.1| PREDICTED: monogalactosyldiacylglycerol synthase, chloroplastic [Fragaria vesca subsp. vesca] Length = 525 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 170 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 211 >ref|XP_007222305.1| hypothetical protein PRUPE_ppa003927mg [Prunus persica] gi|462419241|gb|EMJ23504.1| hypothetical protein PRUPE_ppa003927mg [Prunus persica] Length = 539 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 181 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 222 >ref|XP_002283410.2| PREDICTED: monogalactosyldiacylglycerol synthase, chloroplastic [Vitis vinifera] Length = 528 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 170 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 211 >emb|CAN84152.1| hypothetical protein VITISV_023773 [Vitis vinifera] Length = 520 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 162 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 203 >ref|XP_010095402.1| putative monogalactosyldiacylglycerol synthase [Morus notabilis] gi|587870818|gb|EXB60094.1| putative monogalactosyldiacylglycerol synthase [Morus notabilis] Length = 542 Score = 95.9 bits (237), Expect = 1e-17 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLW+DHTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 178 QVFVTDLWTDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 219 >ref|XP_009363377.1| PREDICTED: probable monogalactosyldiacylglycerol synthase, chloroplastic [Pyrus x bretschneideri] Length = 541 Score = 95.9 bits (237), Expect = 1e-17 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGP WK+TYYGT+P Sbjct: 184 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTSP 225 >ref|XP_002515397.1| 1,2-diacylglycerol 3-beta-galactosyltransferase, putative [Ricinus communis] gi|223545341|gb|EEF46846.1| 1,2-diacylglycerol 3-beta-galactosyltransferase, putative [Ricinus communis] Length = 535 Score = 95.1 bits (235), Expect = 2e-17 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVF+TDLWS+HTPWPFNQLPRSYNFLVKHGP WK+TYYGTAP Sbjct: 177 QVFITDLWSEHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAP 218 >ref|XP_007161099.1| hypothetical protein PHAVU_001G042600g [Phaseolus vulgaris] gi|561034563|gb|ESW33093.1| hypothetical protein PHAVU_001G042600g [Phaseolus vulgaris] Length = 523 Score = 94.7 bits (234), Expect = 2e-17 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLW+DHTPWPFNQLPRSY+FLVKHGP WKLTYYGTAP Sbjct: 165 QVFVTDLWADHTPWPFNQLPRSYSFLVKHGPLWKLTYYGTAP 206 >ref|XP_010670850.1| PREDICTED: monogalactosyldiacylglycerol synthase, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870865931|gb|KMT16969.1| hypothetical protein BVRB_2g044370 [Beta vulgaris subsp. vulgaris] Length = 522 Score = 94.4 bits (233), Expect = 3e-17 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLWS+HTPWPFNQLP+SYNFLVKHGP WK+TYYGTAP Sbjct: 164 QVFVTDLWSEHTPWPFNQLPKSYNFLVKHGPLWKMTYYGTAP 205 >ref|XP_014502519.1| PREDICTED: probable monogalactosyldiacylglycerol synthase, chloroplastic isoform X2 [Vigna radiata var. radiata] Length = 469 Score = 94.0 bits (232), Expect = 4e-17 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLW+DHTPWPFNQLPRSY+FLVKHGP WK+TYYGTAP Sbjct: 165 QVFVTDLWADHTPWPFNQLPRSYSFLVKHGPLWKMTYYGTAP 206 >ref|XP_014502518.1| PREDICTED: probable monogalactosyldiacylglycerol synthase, chloroplastic isoform X1 [Vigna radiata var. radiata] Length = 523 Score = 94.0 bits (232), Expect = 4e-17 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLW+DHTPWPFNQLPRSY+FLVKHGP WK+TYYGTAP Sbjct: 165 QVFVTDLWADHTPWPFNQLPRSYSFLVKHGPLWKMTYYGTAP 206 >gb|KOM48781.1| hypothetical protein LR48_Vigan07g248500 [Vigna angularis] Length = 525 Score = 94.0 bits (232), Expect = 4e-17 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 128 QVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPSWKLTYYGTAP 3 QVFVTDLW+DHTPWPFNQLPRSY+FLVKHGP WK+TYYGTAP Sbjct: 167 QVFVTDLWADHTPWPFNQLPRSYSFLVKHGPLWKMTYYGTAP 208