BLASTX nr result
ID: Zanthoxylum22_contig00029856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00029856 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO45663.1| hypothetical protein CISIN_1g044573mg, partial [C... 69 2e-09 ref|XP_006447217.1| hypothetical protein CICLE_v10014357mg [Citr... 69 2e-09 gb|KDO36128.1| hypothetical protein CISIN_1g038574mg, partial [C... 68 2e-09 >gb|KDO45663.1| hypothetical protein CISIN_1g044573mg, partial [Citrus sinensis] Length = 185 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +2 Query: 98 LQGGFAAVPQLHFEVGSSSFLSTRNIRRQRWGLVGSFCHFRN 223 L+GGFAAVPQLHF+V SSSFLSTRN RR++W LV S CH RN Sbjct: 9 LKGGFAAVPQLHFDVVSSSFLSTRNRRRKKWSLVESVCHSRN 50 >ref|XP_006447217.1| hypothetical protein CICLE_v10014357mg [Citrus clementina] gi|568831365|ref|XP_006469938.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46610-like [Citrus sinensis] gi|557549828|gb|ESR60457.1| hypothetical protein CICLE_v10014357mg [Citrus clementina] Length = 768 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +2 Query: 98 LQGGFAAVPQLHFEVGSSSFLSTRNIRRQRWGLVGSFCHFRN 223 L+GGFAAVPQLHF+V SSSFLSTRN RR++W LV S CH RN Sbjct: 9 LKGGFAAVPQLHFDVVSSSFLSTRNRRRKKWSLVESVCHSRN 50 >gb|KDO36128.1| hypothetical protein CISIN_1g038574mg, partial [Citrus sinensis] Length = 179 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 101 QGGFAAVPQLHFEVGSSSFLSTRNIRRQRWGLVGSFCHFRN 223 +GGFAAVPQLHFEV SSSFLSTRN RR++W LV S CH RN Sbjct: 10 KGGFAAVPQLHFEVVSSSFLSTRNRRRKKWSLVESVCHSRN 50