BLASTX nr result
ID: Zanthoxylum22_contig00029514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00029514 (472 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011005292.1| PREDICTED: gamma-tubulin complex component 3... 59 1e-06 ref|XP_010257504.1| PREDICTED: gamma-tubulin complex component 3... 59 1e-06 gb|KDO70888.1| hypothetical protein CISIN_1g006554mg [Citrus sin... 59 1e-06 ref|XP_006492839.1| PREDICTED: gamma-tubulin complex component 3... 59 1e-06 ref|XP_006429906.1| hypothetical protein CICLE_v10011052mg [Citr... 59 1e-06 ref|XP_008442226.1| PREDICTED: gamma-tubulin complex component 3... 58 3e-06 ref|XP_004144694.1| PREDICTED: gamma-tubulin complex component 3... 58 3e-06 ref|XP_011075100.1| PREDICTED: gamma-tubulin complex component 3... 56 9e-06 ref|XP_008240905.1| PREDICTED: gamma-tubulin complex component 3... 56 9e-06 ref|XP_007203767.1| hypothetical protein PRUPE_ppa002938mg [Prun... 56 9e-06 >ref|XP_011005292.1| PREDICTED: gamma-tubulin complex component 3-like [Populus euphratica] gi|743922435|ref|XP_011005293.1| PREDICTED: gamma-tubulin complex component 3-like [Populus euphratica] Length = 861 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRPRV**NC 372 LPVQQHVDLKFL FRLDFTEFYSRLRP NC Sbjct: 829 LPVQQHVDLKFLFFRLDFTEFYSRLRPGTWQNC 861 >ref|XP_010257504.1| PREDICTED: gamma-tubulin complex component 3 [Nelumbo nucifera] Length = 858 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRP 390 LPVQQHVDLKFLLFRLDFTEFYSRLRP Sbjct: 827 LPVQQHVDLKFLLFRLDFTEFYSRLRP 853 >gb|KDO70888.1| hypothetical protein CISIN_1g006554mg [Citrus sinensis] Length = 640 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRPRV 384 LPVQQHVDLKFLLFRLDFTEFY+RLRP V Sbjct: 612 LPVQQHVDLKFLLFRLDFTEFYTRLRPSV 640 >ref|XP_006492839.1| PREDICTED: gamma-tubulin complex component 3 homolog [Citrus sinensis] Length = 853 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRPRV 384 LPVQQHVDLKFLLFRLDFTEFY+RLRP V Sbjct: 825 LPVQQHVDLKFLLFRLDFTEFYTRLRPSV 853 >ref|XP_006429906.1| hypothetical protein CICLE_v10011052mg [Citrus clementina] gi|557531963|gb|ESR43146.1| hypothetical protein CICLE_v10011052mg [Citrus clementina] Length = 853 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRPRV 384 LPVQQHVDLKFLLFRLDFTEFY+RLRP V Sbjct: 825 LPVQQHVDLKFLLFRLDFTEFYTRLRPSV 853 >ref|XP_008442226.1| PREDICTED: gamma-tubulin complex component 3 [Cucumis melo] Length = 846 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRPRV 384 LP+QQHVDLKFLLFRLDFTEFYS+LRP V Sbjct: 818 LPLQQHVDLKFLLFRLDFTEFYSQLRPHV 846 >ref|XP_004144694.1| PREDICTED: gamma-tubulin complex component 3 [Cucumis sativus] gi|700199707|gb|KGN54865.1| hypothetical protein Csa_4G561690 [Cucumis sativus] Length = 846 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRPRV 384 LP+QQHVDLKFLLFRLDFTEFYS+LRP V Sbjct: 818 LPLQQHVDLKFLLFRLDFTEFYSQLRPHV 846 >ref|XP_011075100.1| PREDICTED: gamma-tubulin complex component 3 [Sesamum indicum] Length = 927 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRP 390 LP+QQHVDLKFL+FRLDFTEFYS+LRP Sbjct: 893 LPIQQHVDLKFLMFRLDFTEFYSQLRP 919 >ref|XP_008240905.1| PREDICTED: gamma-tubulin complex component 3 [Prunus mume] Length = 854 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRP 390 LP+QQHVDLKFLLFRLDFTEFYS+LRP Sbjct: 826 LPMQQHVDLKFLLFRLDFTEFYSQLRP 852 >ref|XP_007203767.1| hypothetical protein PRUPE_ppa002938mg [Prunus persica] gi|462399298|gb|EMJ04966.1| hypothetical protein PRUPE_ppa002938mg [Prunus persica] Length = 620 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 470 LPVQQHVDLKFLLFRLDFTEFYSRLRP 390 LP+QQHVDLKFLLFRLDFTEFYS+LRP Sbjct: 592 LPMQQHVDLKFLLFRLDFTEFYSQLRP 618