BLASTX nr result
ID: Zanthoxylum22_contig00029200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00029200 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO44556.1| hypothetical protein CISIN_1g008129mg [Citrus sin... 79 1e-12 ref|XP_006487703.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_006442666.1| hypothetical protein CICLE_v10019470mg [Citr... 79 1e-12 >gb|KDO44556.1| hypothetical protein CISIN_1g008129mg [Citrus sinensis] gi|641825281|gb|KDO44557.1| hypothetical protein CISIN_1g008129mg [Citrus sinensis] Length = 577 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = -2 Query: 159 MGYTFVPPNSIVELHCLHNMPWCSSHIGLLHRVENNRRSQCYSQLRGDLGAGR 1 MGYT VPPNSI+ELHCL N+ WCS + L H V NN R+Q YSQLR DLGAGR Sbjct: 1 MGYTVVPPNSIIELHCLPNLQWCSRQVSLQHGVVNNHRTQFYSQLR-DLGAGR 52 >ref|XP_006487703.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like isoform X1 [Citrus sinensis] gi|568868940|ref|XP_006487704.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like isoform X2 [Citrus sinensis] gi|568868942|ref|XP_006487705.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like isoform X3 [Citrus sinensis] Length = 577 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = -2 Query: 159 MGYTFVPPNSIVELHCLHNMPWCSSHIGLLHRVENNRRSQCYSQLRGDLGAGR 1 MGYT VPPNSI+ELHCL N+ WCS + L H V NN R+Q YSQLR DLGAGR Sbjct: 1 MGYTVVPPNSIIELHCLPNLQWCSRQVSLQHGVVNNHRTQFYSQLR-DLGAGR 52 >ref|XP_006442666.1| hypothetical protein CICLE_v10019470mg [Citrus clementina] gi|567900358|ref|XP_006442667.1| hypothetical protein CICLE_v10019470mg [Citrus clementina] gi|557544928|gb|ESR55906.1| hypothetical protein CICLE_v10019470mg [Citrus clementina] gi|557544929|gb|ESR55907.1| hypothetical protein CICLE_v10019470mg [Citrus clementina] Length = 577 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = -2 Query: 159 MGYTFVPPNSIVELHCLHNMPWCSSHIGLLHRVENNRRSQCYSQLRGDLGAGR 1 MGYT VPPNSI+ELHCL N+ WCS + L H V NN R+Q YSQLR DLGAGR Sbjct: 1 MGYTVVPPNSIIELHCLPNLQWCSRQVSLQHGVVNNHRTQFYSQLR-DLGAGR 52