BLASTX nr result
ID: Zanthoxylum22_contig00028872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00028872 (328 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432661.1| hypothetical protein CICLE_v10003017mg [Citr... 73 7e-11 >ref|XP_006432661.1| hypothetical protein CICLE_v10003017mg [Citrus clementina] gi|557534783|gb|ESR45901.1| hypothetical protein CICLE_v10003017mg [Citrus clementina] Length = 80 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/38 (86%), Positives = 33/38 (86%) Frame = +3 Query: 213 NHVGQQTPWMNHGSFRGPRKHLVDPTAAEEQPFEVPKL 326 NHV Q P MNHGSFRGPRKHLVDPTAAEE PFEVPKL Sbjct: 41 NHVWQHKPQMNHGSFRGPRKHLVDPTAAEEHPFEVPKL 78