BLASTX nr result
ID: Zanthoxylum22_contig00028655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00028655 (379 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO54751.1| hypothetical protein CISIN_1g0358471mg, partial [... 58 2e-06 >gb|KDO54751.1| hypothetical protein CISIN_1g0358471mg, partial [Citrus sinensis] Length = 331 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 95 LLQNVTLMLQSVDLTNPDECTETYALIFQRC 3 +++NVTL+LQS+DLTNPDECT TYALIFQRC Sbjct: 2 VIKNVTLLLQSMDLTNPDECTVTYALIFQRC 32