BLASTX nr result
ID: Zanthoxylum22_contig00027272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00027272 (306 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO64491.1| hypothetical protein CISIN_1g029262mg [Citrus sin... 57 4e-06 gb|KDO64490.1| hypothetical protein CISIN_1g029262mg [Citrus sin... 57 4e-06 ref|XP_006493262.1| PREDICTED: uncharacterized protein LOC102608... 57 4e-06 ref|XP_006485180.1| PREDICTED: uncharacterized protein LOC102607... 57 4e-06 ref|XP_006440909.1| hypothetical protein CICLE_v10021956mg [Citr... 57 4e-06 ref|XP_006436905.1| hypothetical protein CICLE_v10032601mg [Citr... 57 4e-06 >gb|KDO64491.1| hypothetical protein CISIN_1g029262mg [Citrus sinensis] Length = 161 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -1 Query: 117 PPIRVSGDTLKSISFKASTSKTDAETHAPTSPGLRRRIV 1 PP+RVS D L+S S K STSK+D ET AP+SPGLRRR V Sbjct: 41 PPVRVSEDALRSNSLKTSTSKSDGETQAPSSPGLRRRFV 79 >gb|KDO64490.1| hypothetical protein CISIN_1g029262mg [Citrus sinensis] Length = 196 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -1 Query: 117 PPIRVSGDTLKSISFKASTSKTDAETHAPTSPGLRRRIV 1 PP+RVS D L+S S K STSK+D ET AP+SPGLRRR V Sbjct: 76 PPVRVSEDALRSNSLKTSTSKSDGETQAPSSPGLRRRFV 114 >ref|XP_006493262.1| PREDICTED: uncharacterized protein LOC102608784 [Citrus sinensis] Length = 149 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -1 Query: 117 PPIRVSGDTLKSISFKASTSKTDAETHAPTSPGLRRRIV 1 PP+RVS D L+S S K STSK+D ET AP+SPGLRRR V Sbjct: 76 PPVRVSEDALRSNSLKTSTSKSDGETQAPSSPGLRRRFV 114 >ref|XP_006485180.1| PREDICTED: uncharacterized protein LOC102607374, partial [Citrus sinensis] Length = 114 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -1 Query: 117 PPIRVSGDTLKSISFKASTSKTDAETHAPTSPGLRRRIV 1 PP+RVS D L+S S K STSK+D ET AP+SPGLRRR V Sbjct: 76 PPVRVSEDALRSNSLKTSTSKSDGETQAPSSPGLRRRFV 114 >ref|XP_006440909.1| hypothetical protein CICLE_v10021956mg [Citrus clementina] gi|567896844|ref|XP_006440910.1| hypothetical protein CICLE_v10021956mg [Citrus clementina] gi|557543171|gb|ESR54149.1| hypothetical protein CICLE_v10021956mg [Citrus clementina] gi|557543172|gb|ESR54150.1| hypothetical protein CICLE_v10021956mg [Citrus clementina] Length = 240 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -1 Query: 117 PPIRVSGDTLKSISFKASTSKTDAETHAPTSPGLRRRIV 1 PP+RVS D L+S S K STSK+D ET AP+SPGLRRR V Sbjct: 76 PPVRVSEDALRSNSLKTSTSKSDGETQAPSSPGLRRRFV 114 >ref|XP_006436905.1| hypothetical protein CICLE_v10032601mg [Citrus clementina] gi|567888768|ref|XP_006436906.1| hypothetical protein CICLE_v10032601mg [Citrus clementina] gi|568880717|ref|XP_006493256.1| PREDICTED: vesicle transport protein USE1-like [Citrus sinensis] gi|557539101|gb|ESR50145.1| hypothetical protein CICLE_v10032601mg [Citrus clementina] gi|557539102|gb|ESR50146.1| hypothetical protein CICLE_v10032601mg [Citrus clementina] Length = 240 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -1 Query: 117 PPIRVSGDTLKSISFKASTSKTDAETHAPTSPGLRRRIV 1 PP+RVS D L+S S K STSK+D ET AP+SPGLRRR V Sbjct: 76 PPVRVSEDALRSNSLKTSTSKSDGETQAPSSPGLRRRFV 114