BLASTX nr result
ID: Zanthoxylum22_contig00026071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00026071 (436 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468028.1| PREDICTED: heat shock 70 kDa protein 16-like... 65 1e-08 ref|XP_006449031.1| hypothetical protein CICLE_v10014383mg [Citr... 65 1e-08 >ref|XP_006468028.1| PREDICTED: heat shock 70 kDa protein 16-like [Citrus sinensis] gi|641856690|gb|KDO75456.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis] gi|641856691|gb|KDO75457.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis] Length = 768 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 436 PKYADPILWSSEIKRKLEALDLTCKCIMRSNSSPPV 329 PK ADPILWS+EIKRK EALDLTCKCIMRSN S P+ Sbjct: 714 PKDADPILWSTEIKRKSEALDLTCKCIMRSNPSVPI 749 >ref|XP_006449031.1| hypothetical protein CICLE_v10014383mg [Citrus clementina] gi|557551642|gb|ESR62271.1| hypothetical protein CICLE_v10014383mg [Citrus clementina] Length = 752 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 436 PKYADPILWSSEIKRKLEALDLTCKCIMRSNSSPPV 329 PK ADPILWS+EIKRK EALDLTCKCIMRSN S P+ Sbjct: 698 PKDADPILWSTEIKRKSEALDLTCKCIMRSNPSVPI 733