BLASTX nr result
ID: Zanthoxylum22_contig00024977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00024977 (413 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006485766.1| PREDICTED: carbon catabolite repressor prote... 66 9e-09 ref|XP_006485765.1| PREDICTED: carbon catabolite repressor prote... 66 9e-09 gb|KDO64533.1| hypothetical protein CISIN_1g021001mg [Citrus sin... 65 3e-08 ref|XP_006440934.1| hypothetical protein CICLE_v10020050mg [Citr... 65 3e-08 >ref|XP_006485766.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like isoform X2 [Citrus sinensis] Length = 464 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 93 ICFLSSRARIIAEKWGNIPVVLAGDFNVTPQ 1 ICFLSSRARI+AEKWGNIPVVLAGDFN+TPQ Sbjct: 255 ICFLSSRARIVAEKWGNIPVVLAGDFNITPQ 285 >ref|XP_006485765.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like isoform X1 [Citrus sinensis] Length = 501 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 93 ICFLSSRARIIAEKWGNIPVVLAGDFNVTPQ 1 ICFLSSRARI+AEKWGNIPVVLAGDFN+TPQ Sbjct: 255 ICFLSSRARIVAEKWGNIPVVLAGDFNITPQ 285 >gb|KDO64533.1| hypothetical protein CISIN_1g021001mg [Citrus sinensis] Length = 318 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 93 ICFLSSRARIIAEKWGNIPVVLAGDFNVTPQ 1 ICFLSSRA+I+AEKWGNIPVVLAGDFN+TPQ Sbjct: 98 ICFLSSRAQIVAEKWGNIPVVLAGDFNITPQ 128 >ref|XP_006440934.1| hypothetical protein CICLE_v10020050mg [Citrus clementina] gi|557543196|gb|ESR54174.1| hypothetical protein CICLE_v10020050mg [Citrus clementina] Length = 464 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 93 ICFLSSRARIIAEKWGNIPVVLAGDFNVTPQ 1 ICFLSSRA+I+AEKWGNIPVVLAGDFN+TPQ Sbjct: 255 ICFLSSRAQIVAEKWGNIPVVLAGDFNITPQ 285