BLASTX nr result
ID: Zanthoxylum22_contig00024893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00024893 (259 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO76031.1| hypothetical protein CISIN_1g007827mg [Citrus sin... 67 5e-09 ref|XP_006439662.1| hypothetical protein CICLE_v10019426mg [Citr... 67 5e-09 ref|XP_006476663.1| PREDICTED: probable peptide/nitrate transpor... 67 7e-09 gb|ADH21397.1| nitrate transporter [Citrus trifoliata] 67 7e-09 ref|XP_002511509.1| nitrate transporter, putative [Ricinus commu... 62 2e-07 gb|KHG08723.1| hypothetical protein F383_35629 [Gossypium arboreum] 59 2e-06 ref|XP_006477526.1| PREDICTED: probable peptide/nitrate transpor... 58 2e-06 ref|XP_006439663.1| hypothetical protein CICLE_v10019319mg [Citr... 58 2e-06 ref|XP_007037197.1| Major facilitator superfamily protein isofor... 58 2e-06 ref|XP_007037196.1| Major facilitator superfamily protein isofor... 58 2e-06 ref|XP_009626986.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik... 58 3e-06 ref|XP_006476665.1| PREDICTED: probable peptide/nitrate transpor... 57 5e-06 dbj|BAB19756.1| nitrate transporter NRT1-1 [Glycine max] 56 9e-06 ref|XP_003524995.1| PREDICTED: probable peptide/nitrate transpor... 56 9e-06 >gb|KDO76031.1| hypothetical protein CISIN_1g007827mg [Citrus sinensis] Length = 588 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = -3 Query: 119 MEKNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 MEKN+K A V T DDEPQLNYRGWKSMPFVIGNETFE Sbjct: 1 MEKNSKTAVVAT---DDEPQLNYRGWKSMPFVIGNETFE 36 >ref|XP_006439662.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] gi|557541924|gb|ESR52902.1| hypothetical protein CICLE_v10019426mg [Citrus clementina] Length = 588 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = -3 Query: 119 MEKNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 MEKN+K A V T DDEPQLNYRGWKSMPFVIGNETFE Sbjct: 1 MEKNSKTAVVAT---DDEPQLNYRGWKSMPFVIGNETFE 36 >ref|XP_006476663.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Citrus sinensis] Length = 588 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -3 Query: 119 MEKNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 MEKN K A V T DDEPQLNYRGWKSMPFVIGNETFE Sbjct: 1 MEKNNKTAVVAT---DDEPQLNYRGWKSMPFVIGNETFE 36 >gb|ADH21397.1| nitrate transporter [Citrus trifoliata] Length = 588 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -3 Query: 119 MEKNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 MEKN K A TT DDEPQLNYRGWKSMPFVIGNETFE Sbjct: 1 MEKNNKTAVFTT---DDEPQLNYRGWKSMPFVIGNETFE 36 >ref|XP_002511509.1| nitrate transporter, putative [Ricinus communis] gi|223550624|gb|EEF52111.1| nitrate transporter, putative [Ricinus communis] Length = 602 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 125 ETMEKNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 ETME N K A T HD+EP +NYRGWK+MPF+IGNETFE Sbjct: 13 ETMESNEKDDA---TAHDEEPNINYRGWKAMPFIIGNETFE 50 >gb|KHG08723.1| hypothetical protein F383_35629 [Gossypium arboreum] Length = 602 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 125 ETMEKNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 E MEK KA T +DEP++NYRGWK+MPF+IGNETFE Sbjct: 11 EAMEKEEKATVAT----NDEPEINYRGWKAMPFIIGNETFE 47 >ref|XP_006477526.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Citrus sinensis] Length = 441 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/51 (54%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 152 LELDQLFALETME-KNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 LEL++++ TME +N K T + DEP++NYRGWK+MPF+IGNETFE Sbjct: 17 LELEKIYENRTMELENVKK---TVGNDHDEPKINYRGWKAMPFIIGNETFE 64 >ref|XP_006439663.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] gi|557541925|gb|ESR52903.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] Length = 621 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/51 (54%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 152 LELDQLFALETME-KNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 LEL++++ TME +N K T + DEP++NYRGWK+MPF+IGNETFE Sbjct: 17 LELEKIYENRTMELENVKK---TVGNDHDEPKINYRGWKAMPFIIGNETFE 64 >ref|XP_007037197.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao] gi|508774442|gb|EOY21698.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao] Length = 598 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 5/44 (11%) Frame = -3 Query: 119 MEKNTKAAAVT-----TTDHDDEPQLNYRGWKSMPFVIGNETFE 3 MEKN K A T TTDH EP++NYRGWK+MPF+IGNETFE Sbjct: 1 MEKNDKEAMGTNQKTVTTDH--EPEINYRGWKAMPFIIGNETFE 42 >ref|XP_007037196.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] gi|508774441|gb|EOY21697.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] Length = 593 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 5/44 (11%) Frame = -3 Query: 119 MEKNTKAAAVT-----TTDHDDEPQLNYRGWKSMPFVIGNETFE 3 MEKN K A T TTDH EP++NYRGWK+MPF+IGNETFE Sbjct: 1 MEKNDKEAMGTNQKTVTTDH--EPEINYRGWKAMPFIIGNETFE 42 >ref|XP_009626986.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Nicotiana tomentosiformis] Length = 602 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 128 LETMEKNTKAAA-VTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 +E MEKN K A+ + D++ EPQ+NYRG K+MPF+IGNETFE Sbjct: 6 IEAMEKNEKTASTIRDADNEKEPQINYRGVKAMPFIIGNETFE 48 >ref|XP_006476665.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like isoform X1 [Citrus sinensis] Length = 621 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = -3 Query: 152 LELDQLFALETMEKNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 LEL++++ TME K DHD EP+++YRGWK+MPF+IGNETFE Sbjct: 17 LELEKIYENRTMELE-KVKKTVGNDHD-EPKIHYRGWKAMPFIIGNETFE 64 >dbj|BAB19756.1| nitrate transporter NRT1-1 [Glycine max] Length = 597 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -3 Query: 128 LETMEKNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 +E MEKN K+ D+EP++NYRGWK MPF+IGNETFE Sbjct: 4 VEAMEKNEKSVT------DEEPKINYRGWKVMPFIIGNETFE 39 >ref|XP_003524995.1| PREDICTED: probable peptide/nitrate transporter At3g47960-like [Glycine max] gi|947108642|gb|KRH56968.1| hypothetical protein GLYMA_05G030400 [Glycine max] Length = 596 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -3 Query: 128 LETMEKNTKAAAVTTTDHDDEPQLNYRGWKSMPFVIGNETFE 3 +E MEKN K+ D+EP++NYRGWK MPF+IGNETFE Sbjct: 4 VEAMEKNEKSVT------DEEPKINYRGWKVMPFIIGNETFE 39