BLASTX nr result
ID: Zanthoxylum22_contig00023935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00023935 (336 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432082.1| hypothetical protein CICLE_v10002216mg [Citr... 67 5e-09 ref|XP_004288484.1| PREDICTED: uncharacterized protein LOC101312... 65 2e-08 ref|XP_010243503.1| PREDICTED: uncharacterized protein LOC104587... 64 3e-08 ref|XP_012460617.1| PREDICTED: uncharacterized protein LOC105780... 64 4e-08 ref|XP_011099688.1| PREDICTED: uncharacterized protein LOC105178... 64 4e-08 ref|XP_007048538.1| Histone-lysine N-methyltransferase SETD1A, p... 64 4e-08 ref|XP_002273892.2| PREDICTED: uncharacterized protein LOC100257... 64 4e-08 emb|CAN68197.1| hypothetical protein VITISV_039761 [Vitis vinifera] 64 4e-08 gb|KFK25231.1| hypothetical protein AALP_AA8G084400 [Arabis alpina] 63 1e-07 ref|XP_009355865.1| PREDICTED: uncharacterized protein LOC103946... 62 1e-07 ref|XP_008337155.1| PREDICTED: uncharacterized protein LOC103400... 62 1e-07 ref|XP_011031096.1| PREDICTED: sphingosine kinase B [Populus eup... 62 2e-07 ref|XP_010452893.1| PREDICTED: uncharacterized protein LOC104734... 62 2e-07 ref|XP_010423022.1| PREDICTED: uncharacterized protein LOC104708... 62 2e-07 ref|XP_010025728.1| PREDICTED: uncharacterized protein LOC104415... 62 2e-07 ref|XP_008227587.1| PREDICTED: uncharacterized protein LOC103327... 62 2e-07 ref|XP_002306281.1| hypothetical protein POPTR_0005s07100g [Popu... 62 2e-07 ref|NP_680159.1| uncharacterized protein [Arabidopsis thaliana] ... 62 2e-07 ref|XP_006289496.1| hypothetical protein CARUB_v10003030mg [Caps... 62 2e-07 ref|XP_007211710.1| hypothetical protein PRUPE_ppa009323mg [Prun... 62 2e-07 >ref|XP_006432082.1| hypothetical protein CICLE_v10002216mg [Citrus clementina] gi|567879049|ref|XP_006432083.1| hypothetical protein CICLE_v10002216mg [Citrus clementina] gi|568820881|ref|XP_006464932.1| PREDICTED: uncharacterized protein LOC102616047 isoform X1 [Citrus sinensis] gi|568820883|ref|XP_006464933.1| PREDICTED: uncharacterized protein LOC102616047 isoform X2 [Citrus sinensis] gi|557534204|gb|ESR45322.1| hypothetical protein CICLE_v10002216mg [Citrus clementina] gi|557534205|gb|ESR45323.1| hypothetical protein CICLE_v10002216mg [Citrus clementina] gi|641833196|gb|KDO52214.1| hypothetical protein CISIN_1g040281mg [Citrus sinensis] Length = 258 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 RIRELRLPALDF+NAPLRILQYVVLMTDDVFY A Sbjct: 225 RIRELRLPALDFKNAPLRILQYVVLMTDDVFYLA 258 >ref|XP_004288484.1| PREDICTED: uncharacterized protein LOC101312483 [Fragaria vesca subsp. vesca] Length = 259 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 RIRELRLPALDFRNAPLRILQY++LMTDD+FY A Sbjct: 226 RIRELRLPALDFRNAPLRILQYILLMTDDMFYLA 259 >ref|XP_010243503.1| PREDICTED: uncharacterized protein LOC104587547 [Nelumbo nucifera] Length = 315 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 RIRELRLP LDFRNAPLRILQY++LMTDD+FY A Sbjct: 282 RIRELRLPPLDFRNAPLRILQYIILMTDDLFYLA 315 >ref|XP_012460617.1| PREDICTED: uncharacterized protein LOC105780687 [Gossypium raimondii] gi|823255918|ref|XP_012460619.1| PREDICTED: uncharacterized protein LOC105780687 [Gossypium raimondii] gi|823255920|ref|XP_012460620.1| PREDICTED: uncharacterized protein LOC105780687 [Gossypium raimondii] gi|763808420|gb|KJB75322.1| hypothetical protein B456_012G037400 [Gossypium raimondii] gi|763808421|gb|KJB75323.1| hypothetical protein B456_012G037400 [Gossypium raimondii] gi|763808422|gb|KJB75324.1| hypothetical protein B456_012G037400 [Gossypium raimondii] Length = 329 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFY 239 RIRELRLP+LDFRNAPL+ILQY+VLMTDDVFY Sbjct: 296 RIRELRLPSLDFRNAPLKILQYIVLMTDDVFY 327 >ref|XP_011099688.1| PREDICTED: uncharacterized protein LOC105178045 [Sesamum indicum] Length = 291 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+REL+LP+LDFRNAPLRILQY++LMTDDVFY A Sbjct: 258 RVRELKLPSLDFRNAPLRILQYILLMTDDVFYLA 291 >ref|XP_007048538.1| Histone-lysine N-methyltransferase SETD1A, putative [Theobroma cacao] gi|508700799|gb|EOX92695.1| Histone-lysine N-methyltransferase SETD1A, putative [Theobroma cacao] Length = 321 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFY 239 RIRELRLP+LDFRNAPL+ILQY+VLMTDDVFY Sbjct: 288 RIRELRLPSLDFRNAPLKILQYIVLMTDDVFY 319 >ref|XP_002273892.2| PREDICTED: uncharacterized protein LOC100257607 [Vitis vinifera] Length = 313 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP LDFRNAPLRILQY++LMTDD+FY A Sbjct: 280 RVRELRLPPLDFRNAPLRILQYILLMTDDIFYLA 313 >emb|CAN68197.1| hypothetical protein VITISV_039761 [Vitis vinifera] Length = 313 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP LDFRNAPLRILQY++LMTDD+FY A Sbjct: 280 RVRELRLPPLDFRNAPLRILQYILLMTDDIFYLA 313 >gb|KFK25231.1| hypothetical protein AALP_AA8G084400 [Arabis alpina] Length = 299 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP+LDFRNAPLRILQY++LMTDDVF+ A Sbjct: 266 RVRELRLPSLDFRNAPLRILQYLMLMTDDVFFLA 299 >ref|XP_009355865.1| PREDICTED: uncharacterized protein LOC103946794 [Pyrus x bretschneideri] Length = 290 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 RIRELRLP LDFRNAPLRIL Y++LMTDD+FY A Sbjct: 257 RIRELRLPPLDFRNAPLRILHYILLMTDDIFYLA 290 >ref|XP_008337155.1| PREDICTED: uncharacterized protein LOC103400281 [Malus domestica] Length = 296 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 RIRELRLP LDFRNAPLRIL Y++LMTDD+FY A Sbjct: 263 RIRELRLPPLDFRNAPLRILHYILLMTDDIFYLA 296 >ref|XP_011031096.1| PREDICTED: sphingosine kinase B [Populus euphratica] Length = 306 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 RIRELRLPALDFRN PLRIL Y++LMTDD+FY + Sbjct: 273 RIRELRLPALDFRNTPLRILHYILLMTDDIFYLS 306 >ref|XP_010452893.1| PREDICTED: uncharacterized protein LOC104734911 [Camelina sativa] Length = 314 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP LDFRNAPLRILQY++LMTDD+F+ A Sbjct: 281 RVRELRLPQLDFRNAPLRILQYLMLMTDDIFFLA 314 >ref|XP_010423022.1| PREDICTED: uncharacterized protein LOC104708200 [Camelina sativa] Length = 313 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP LDFRNAPLRILQY++LMTDD+F+ A Sbjct: 280 RVRELRLPQLDFRNAPLRILQYLMLMTDDIFFLA 313 >ref|XP_010025728.1| PREDICTED: uncharacterized protein LOC104415977 [Eucalyptus grandis] Length = 361 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP LDF NAPLRILQYV+LMTDD+FY A Sbjct: 328 RVRELRLPPLDFGNAPLRILQYVLLMTDDIFYLA 361 >ref|XP_008227587.1| PREDICTED: uncharacterized protein LOC103327079 [Prunus mume] gi|645242534|ref|XP_008227588.1| PREDICTED: uncharacterized protein LOC103327079 [Prunus mume] Length = 297 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP LDF NAPLRILQY++LMTDD+FY A Sbjct: 264 RVRELRLPPLDFSNAPLRILQYILLMTDDIFYLA 297 >ref|XP_002306281.1| hypothetical protein POPTR_0005s07100g [Populus trichocarpa] gi|222855730|gb|EEE93277.1| hypothetical protein POPTR_0005s07100g [Populus trichocarpa] Length = 304 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 RIRELRLPALDFRN PLRIL Y++LMTDD+FY + Sbjct: 271 RIRELRLPALDFRNTPLRILHYILLMTDDIFYLS 304 >ref|NP_680159.1| uncharacterized protein [Arabidopsis thaliana] gi|332003965|gb|AED91348.1| uncharacterized protein AT5G08770 [Arabidopsis thaliana] Length = 297 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP LDFRNAPLRILQY++LMTDD+F+ A Sbjct: 264 RVRELRLPQLDFRNAPLRILQYLMLMTDDIFFLA 297 >ref|XP_006289496.1| hypothetical protein CARUB_v10003030mg [Capsella rubella] gi|482558202|gb|EOA22394.1| hypothetical protein CARUB_v10003030mg [Capsella rubella] Length = 304 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP LDFRNAPLRILQY++LMTDD+F+ A Sbjct: 271 RVRELRLPQLDFRNAPLRILQYLMLMTDDIFFLA 304 >ref|XP_007211710.1| hypothetical protein PRUPE_ppa009323mg [Prunus persica] gi|462407575|gb|EMJ12909.1| hypothetical protein PRUPE_ppa009323mg [Prunus persica] Length = 297 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 334 RIRELRLPALDFRNAPLRILQYVVLMTDDVFYFA 233 R+RELRLP LDF NAPLRILQY++LMTDD+FY A Sbjct: 264 RVRELRLPPLDFSNAPLRILQYILLMTDDIFYLA 297