BLASTX nr result
ID: Zanthoxylum22_contig00023352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00023352 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006426641.1| hypothetical protein CICLE_v10026810mg [Citr... 64 6e-08 ref|XP_004287614.1| PREDICTED: protein ELF4-LIKE 3 [Fragaria ves... 56 9e-06 >ref|XP_006426641.1| hypothetical protein CICLE_v10026810mg [Citrus clementina] gi|568823035|ref|XP_006465930.1| PREDICTED: protein ELF4-LIKE 4-like [Citrus sinensis] gi|557528631|gb|ESR39881.1| hypothetical protein CICLE_v10026810mg [Citrus clementina] gi|641846164|gb|KDO65048.1| hypothetical protein CISIN_1g033906mg [Citrus sinensis] Length = 109 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 335 MEGDIFSGTGNNGTQVDGKVMQKFQRSFGQVQD 433 MEGDIFSG GNNGTQV+G+VMQ FQRSFGQVQD Sbjct: 1 MEGDIFSGIGNNGTQVNGRVMQTFQRSFGQVQD 33 >ref|XP_004287614.1| PREDICTED: protein ELF4-LIKE 3 [Fragaria vesca subsp. vesca] Length = 116 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 335 MEGDIFSGTGNNGTQVDGKVMQKFQRSFGQVQD 433 MEGD FSG NGTQ+DGKV+Q FQ+SFGQVQD Sbjct: 1 MEGDTFSGLVGNGTQIDGKVLQTFQKSFGQVQD 33