BLASTX nr result
ID: Zanthoxylum22_contig00023238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00023238 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO72890.1| hypothetical protein CISIN_1g036629mg [Citrus sin... 57 5e-06 ref|XP_006488301.1| PREDICTED: uncharacterized protein LOC102610... 57 5e-06 ref|XP_006424802.1| hypothetical protein CICLE_v10028872mg [Citr... 57 5e-06 >gb|KDO72890.1| hypothetical protein CISIN_1g036629mg [Citrus sinensis] Length = 314 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -3 Query: 340 SFLKFIVGHHLQQ---STSQVLPLASSPTTFRPVLAQKPTVH 224 SFLKFIVGHHLQQ STSQVLPLASSPTTF + +P H Sbjct: 269 SFLKFIVGHHLQQYPSSTSQVLPLASSPTTFSFQTSNRPEAH 310 >ref|XP_006488301.1| PREDICTED: uncharacterized protein LOC102610518 [Citrus sinensis] Length = 314 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -3 Query: 340 SFLKFIVGHHLQQ---STSQVLPLASSPTTFRPVLAQKPTVH 224 SFLKFIVGHHLQQ STSQVLPLASSPTTF + +P H Sbjct: 269 SFLKFIVGHHLQQYPSSTSQVLPLASSPTTFSFQTSNRPEAH 310 >ref|XP_006424802.1| hypothetical protein CICLE_v10028872mg [Citrus clementina] gi|557526736|gb|ESR38042.1| hypothetical protein CICLE_v10028872mg [Citrus clementina] Length = 314 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -3 Query: 340 SFLKFIVGHHLQQ---STSQVLPLASSPTTFRPVLAQKPTVH 224 SFLKFIVGHHLQQ STSQVLPLASSPTTF + +P H Sbjct: 269 SFLKFIVGHHLQQYPSSTSQVLPLASSPTTFSFQTSNRPEAH 310