BLASTX nr result
ID: Zanthoxylum22_contig00022356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00022356 (466 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006423088.1| hypothetical protein CICLE_v10029927mg [Citr... 57 4e-06 >ref|XP_006423088.1| hypothetical protein CICLE_v10029927mg [Citrus clementina] gi|557525022|gb|ESR36328.1| hypothetical protein CICLE_v10029927mg [Citrus clementina] Length = 112 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 7/60 (11%) Frame = +3 Query: 273 NFRVFYQTRFLC------KAIKNSWHPMTRSDNLPIL*KDFKYLRFLIT-QERELSQKKQ 431 N RVF+Q++ L AIKNSW MTRS NLPIL KD ++L LI +ERELSQKKQ Sbjct: 9 NSRVFHQSQCLFHNMITGNAIKNSWRLMTRSYNLPILGKDLQHLSLLIAGEERELSQKKQ 68