BLASTX nr result
ID: Zanthoxylum22_contig00015798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00015798 (266 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabac... 121 2e-25 gb|KDP22997.1| hypothetical protein JCGZ_01719 [Jatropha curcas] 74 6e-11 gb|KMS94058.1| hypothetical protein BVRB_025220 [Beta vulgaris s... 70 5e-10 ref|XP_006435528.1| hypothetical protein CICLE_v10010881mg [Citr... 61 3e-07 >ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabacum] gi|11466023|ref|NP_054565.1| hypothetical protein NitaCp091 [Nicotiana tabacum] gi|78102593|ref|YP_358732.1| hypothetical protein NisyCp089 [Nicotiana sylvestris] gi|78102607|ref|YP_358746.1| hypothetical protein NisyCp103 [Nicotiana sylvestris] gi|81301623|ref|YP_398918.1| hypothetical protein NitoCp088 [Nicotiana tomentosiformis] gi|81301637|ref|YP_398932.1| hypothetical protein NitoCp102 [Nicotiana tomentosiformis] gi|351653935|ref|YP_004891661.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653962|ref|YP_004891675.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11786|emb|CAA26288.1| hypothetical protein [Nicotiana tabacum] gi|11880|emb|CAA77393.1| hypothetical protein [Nicotiana tabacum] gi|473681|gb|AAA84690.1| unknown (chloroplast) [Nicotiana tabacum] gi|1223679|emb|CAA77400.1| hypothetical protein [Nicotiana tabacum] gi|77799620|dbj|BAE46709.1| hypothetical protein [Nicotiana sylvestris] gi|77799634|dbj|BAE46723.1| hypothetical protein [Nicotiana sylvestris] gi|80750982|dbj|BAE48058.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750996|dbj|BAE48072.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453961|gb|AEO95619.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453988|gb|AEO95646.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454071|gb|AEO95728.1| hypothetical protein [synthetic construct] gi|347454097|gb|AEO95754.1| hypothetical protein [synthetic construct] gi|225251|prf||1211235CK ORF 75 Length = 75 Score = 121 bits (303), Expect = 2e-25 Identities = 64/74 (86%), Positives = 66/74 (89%) Frame = +2 Query: 2 RHGTEPLRRSSGSYEGNFEFILVMG*ERELNSMRYNLPLFLSSSVVERSAVN*LVVGSNP 181 RH EPLRRSSGSYEG+FE ILVMG ERELNSMR NL LFLSSSVVERSAVN LVVGSNP Sbjct: 2 RHVREPLRRSSGSYEGSFELILVMGWERELNSMRSNLLLFLSSSVVERSAVNRLVVGSNP 61 Query: 182 TWGDLIHSELKNSK 223 TWGDLI SELKNS+ Sbjct: 62 TWGDLIDSELKNSE 75 >gb|KDP22997.1| hypothetical protein JCGZ_01719 [Jatropha curcas] Length = 742 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 165 TNQLTADRSTTELLRNSGRLYLIEFNSRSQPMTNMNSKFPS 43 TNQLTADRSTTELLRN+GR LIEFNSRSQPMTNM+ KFPS Sbjct: 702 TNQLTADRSTTELLRNNGRFDLIEFNSRSQPMTNMSLKFPS 742 >gb|KMS94058.1| hypothetical protein BVRB_025220 [Beta vulgaris subsp. vulgaris] Length = 42 Score = 70.5 bits (171), Expect = 5e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 165 TNQLTADRSTTELLRNSGRLYLIEFNSRSQPMTNMNSKFPS 43 TNQLT DRSTTELLRN+ RL LIEFNSRSQPMTNM+SK PS Sbjct: 2 TNQLTTDRSTTELLRNNKRLDLIEFNSRSQPMTNMSSKLPS 42 >ref|XP_006435528.1| hypothetical protein CICLE_v10010881mg [Citrus clementina] gi|557537661|gb|ESR48768.1| hypothetical protein CICLE_v10010881mg [Citrus clementina] Length = 108 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 266 LPTFNGQSEPFHSDILNSLIRNESNLPK 183 LPTFNGQSEPFHSDILNSLIRNESNLPK Sbjct: 81 LPTFNGQSEPFHSDILNSLIRNESNLPK 108