BLASTX nr result
ID: Zanthoxylum22_contig00015673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00015673 (267 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO73368.1| hypothetical protein CISIN_1g041511mg, partial [C... 57 7e-08 gb|ACJ86167.1| unknown [Medicago truncatula] gi|388497248|gb|AFK... 61 4e-07 ref|XP_003618144.2| 30S ribosomal S17-like protein [Medicago tru... 58 3e-06 ref|XP_011017573.1| PREDICTED: 30S ribosomal protein S17, chloro... 57 4e-06 ref|XP_011019937.1| PREDICTED: 30S ribosomal protein S17, chloro... 57 4e-06 ref|XP_006381171.1| hypothetical protein POPTR_0006s07990g [Popu... 57 4e-06 ref|XP_006372257.1| ribosomal protein S17 [Populus trichocarpa] ... 57 4e-06 ref|XP_009338674.1| PREDICTED: 30S ribosomal protein S17, chloro... 56 9e-06 ref|XP_009364285.1| PREDICTED: 30S ribosomal protein S17, chloro... 56 9e-06 ref|XP_006453155.1| hypothetical protein CICLE_v10009986mg [Citr... 56 9e-06 ref|XP_006422263.1| hypothetical protein CICLE_v10006280mg [Citr... 56 9e-06 ref|XP_004287439.1| PREDICTED: 30S ribosomal protein S17, chloro... 56 9e-06 ref|XP_007206185.1| hypothetical protein PRUPE_ppa013875mg [Prun... 56 9e-06 >gb|KDO73368.1| hypothetical protein CISIN_1g041511mg, partial [Citrus sinensis] Length = 147 Score = 56.6 bits (135), Expect(2) = 7e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 88 KMKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 +MKSVVG+VVSNKMQKSVVVAVDRLFHHK Sbjct: 41 QMKSVVGLVVSNKMQKSVVVAVDRLFHHK 69 Score = 26.6 bits (57), Expect(2) = 7e-08 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -2 Query: 173 LSCAVNLRQLLPSSSVAVKSGRRSPKGAKNEV 78 LSCAV+LRQLL SV+ S + P K+ V Sbjct: 15 LSCAVDLRQLLWPPSVSSLSIQIGPSQMKSVV 46 >gb|ACJ86167.1| unknown [Medicago truncatula] gi|388497248|gb|AFK36690.1| unknown [Medicago truncatula] Length = 106 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 LWWKSLSTATTTDFCILFETTIPTTDFIF 89 LWW +LSTATTTDFCILFETTIPTT FIF Sbjct: 53 LWWNNLSTATTTDFCILFETTIPTTSFIF 81 >ref|XP_003618144.2| 30S ribosomal S17-like protein [Medicago truncatula] gi|657380699|gb|AES74362.2| 30S ribosomal S17-like protein [Medicago truncatula] Length = 154 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 88 KMKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 KMK VVGMVVSNKMQKSVVVAVDRLFHHK Sbjct: 51 KMKEVVGMVVSNKMQKSVVVAVDRLFHHK 79 >ref|XP_011017573.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Populus euphratica] gi|743805215|ref|XP_011017574.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Populus euphratica] gi|743805219|ref|XP_011017575.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Populus euphratica] Length = 105 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MKSVVGMVVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 28 >ref|XP_011019937.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Populus euphratica] gi|743815432|ref|XP_011019939.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Populus euphratica] gi|743931944|ref|XP_011010256.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Populus euphratica] Length = 105 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MKSVVGMVVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 28 >ref|XP_006381171.1| hypothetical protein POPTR_0006s07990g [Populus trichocarpa] gi|550335748|gb|ERP58968.1| hypothetical protein POPTR_0006s07990g [Populus trichocarpa] Length = 93 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MKSVVGMVVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 28 >ref|XP_006372257.1| ribosomal protein S17 [Populus trichocarpa] gi|550318788|gb|ERP50054.1| ribosomal protein S17 [Populus trichocarpa] Length = 105 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MKSVVGMVVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 28 >ref|XP_009338674.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like isoform X1 [Pyrus x bretschneideri] gi|694421680|ref|XP_009338675.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like isoform X2 [Pyrus x bretschneideri] gi|694421682|ref|XP_009338676.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like isoform X1 [Pyrus x bretschneideri] gi|694421685|ref|XP_009338677.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like isoform X1 [Pyrus x bretschneideri] Length = 98 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MK+VVGMVVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKTVVGMVVSNKMQKSVVVAVDRLFHHK 28 >ref|XP_009364285.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Pyrus x bretschneideri] Length = 98 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MK+VVGMVVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKTVVGMVVSNKMQKSVVVAVDRLFHHK 28 >ref|XP_006453155.1| hypothetical protein CICLE_v10009986mg [Citrus clementina] gi|568840801|ref|XP_006474354.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like isoform X1 [Citrus sinensis] gi|568840803|ref|XP_006474355.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like isoform X2 [Citrus sinensis] gi|557556381|gb|ESR66395.1| hypothetical protein CICLE_v10009986mg [Citrus clementina] Length = 106 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MKSVVG+VVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKSVVGLVVSNKMQKSVVVAVDRLFHHK 28 >ref|XP_006422263.1| hypothetical protein CICLE_v10006280mg [Citrus clementina] gi|568881874|ref|XP_006493774.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Citrus sinensis] gi|557524136|gb|ESR35503.1| hypothetical protein CICLE_v10006280mg [Citrus clementina] gi|641842676|gb|KDO61580.1| hypothetical protein CISIN_1g034020mg [Citrus sinensis] Length = 106 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MKSVVG+VVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKSVVGLVVSNKMQKSVVVAVDRLFHHK 28 >ref|XP_004287439.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 98 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MK+VVGMVVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKTVVGMVVSNKMQKSVVVAVDRLFHHK 28 >ref|XP_007206185.1| hypothetical protein PRUPE_ppa013875mg [Prunus persica] gi|462401827|gb|EMJ07384.1| hypothetical protein PRUPE_ppa013875mg [Prunus persica] Length = 98 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 85 MKSVVGMVVSNKMQKSVVVAVDRLFHHK 2 MK+VVGMVVSNKMQKSVVVAVDRLFHHK Sbjct: 1 MKAVVGMVVSNKMQKSVVVAVDRLFHHK 28