BLASTX nr result
ID: Zanthoxylum22_contig00014690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00014690 (323 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006493944.1| PREDICTED: tryptophan synthase beta chain 1,... 80 5e-13 ref|XP_006452223.1| hypothetical protein CICLE_v10008204mg [Citr... 80 5e-13 ref|XP_011097911.1| PREDICTED: tryptophan synthase beta chain 2,... 77 7e-12 ref|XP_007020961.1| Tryptophan synthase beta-subunit 2 isoform 2... 76 1e-11 ref|XP_002523007.1| tryptophan synthase beta chain, putative [Ri... 75 1e-11 ref|XP_007020962.1| Tryptophan synthase beta-subunit 2 isoform 3... 75 1e-11 ref|XP_007020960.1| Tryptophan synthase beta-subunit 2 isoform 1... 75 2e-11 ref|XP_003551899.1| PREDICTED: tryptophan synthase beta chain 2,... 75 2e-11 ref|XP_009342584.1| PREDICTED: tryptophan synthase beta chain 1-... 74 3e-11 ref|XP_009358128.1| PREDICTED: tryptophan synthase beta chain 1 ... 74 3e-11 ref|XP_008454527.1| PREDICTED: tryptophan synthase beta chain 1 ... 74 3e-11 ref|XP_008366477.1| PREDICTED: tryptophan synthase beta chain 2,... 74 3e-11 ref|XP_004142558.1| PREDICTED: tryptophan synthase beta chain 1 ... 74 3e-11 dbj|BAD83779.1| tryptophan synthase beta subunit [Polygonum tinc... 74 3e-11 ref|XP_012841737.1| PREDICTED: tryptophan synthase beta chain 1-... 74 4e-11 ref|XP_002869581.1| tryptophan synthase beta-subunit [Arabidopsi... 74 4e-11 ref|XP_010539287.1| PREDICTED: tryptophan synthase beta chain 1,... 74 6e-11 ref|XP_010482888.1| PREDICTED: tryptophan synthase beta chain 1,... 74 6e-11 ref|XP_010443059.1| PREDICTED: tryptophan synthase beta chain 1,... 74 6e-11 ref|XP_010448660.1| PREDICTED: tryptophan synthase beta chain 1,... 74 6e-11 >ref|XP_006493944.1| PREDICTED: tryptophan synthase beta chain 1, chloroplastic-like isoform X1 [Citrus sinensis] gi|568882236|ref|XP_006493945.1| PREDICTED: tryptophan synthase beta chain 1, chloroplastic-like isoform X2 [Citrus sinensis] gi|641831186|gb|KDO50253.1| hypothetical protein CISIN_1g012347mg [Citrus sinensis] gi|641831187|gb|KDO50254.1| hypothetical protein CISIN_1g012347mg [Citrus sinensis] Length = 465 Score = 80.5 bits (197), Expect = 5e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIK+LQ+ Sbjct: 426 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKYLQV 465 >ref|XP_006452223.1| hypothetical protein CICLE_v10008204mg [Citrus clementina] gi|557555449|gb|ESR65463.1| hypothetical protein CICLE_v10008204mg [Citrus clementina] Length = 465 Score = 80.5 bits (197), Expect = 5e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIK+LQ+ Sbjct: 426 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKYLQV 465 >ref|XP_011097911.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic [Sesamum indicum] Length = 415 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTL DGTKVV+N SGRGDKDVQTAIKHL+L Sbjct: 376 HALAYLEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKHLEL 415 >ref|XP_007020961.1| Tryptophan synthase beta-subunit 2 isoform 2 [Theobroma cacao] gi|508720589|gb|EOY12486.1| Tryptophan synthase beta-subunit 2 isoform 2 [Theobroma cacao] Length = 471 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTL DGTKVV+N SGRGDKDV TAIKHLQ+ Sbjct: 428 HALAYLEKLCPTLPDGTKVVINCSGRGDKDVHTAIKHLQM 467 >ref|XP_002523007.1| tryptophan synthase beta chain, putative [Ricinus communis] gi|223537819|gb|EEF39437.1| tryptophan synthase beta chain, putative [Ricinus communis] Length = 394 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTLA+GTKVV+N SGRGDKDVQTAIK+LQL Sbjct: 355 HALAYLEKLCPTLANGTKVVLNCSGRGDKDVQTAIKYLQL 394 >ref|XP_007020962.1| Tryptophan synthase beta-subunit 2 isoform 3 [Theobroma cacao] gi|508720590|gb|EOY12487.1| Tryptophan synthase beta-subunit 2 isoform 3 [Theobroma cacao] Length = 467 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTL DGTKVV+N SGRGDKDV TAIKHLQ+ Sbjct: 428 HALAYLEKLCPTLPDGTKVVINCSGRGDKDVHTAIKHLQV 467 >ref|XP_007020960.1| Tryptophan synthase beta-subunit 2 isoform 1 [Theobroma cacao] gi|508720588|gb|EOY12485.1| Tryptophan synthase beta-subunit 2 isoform 1 [Theobroma cacao] Length = 479 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQ 205 HALAYLEKLCPTL DGTKVV+N SGRGDKDV TAIKHLQ Sbjct: 428 HALAYLEKLCPTLPDGTKVVINCSGRGDKDVHTAIKHLQ 466 >ref|XP_003551899.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Glycine max] gi|734371605|gb|KHN19648.1| Tryptophan synthase beta chain 2, chloroplastic [Glycine soja] gi|947049327|gb|KRG98855.1| hypothetical protein GLYMA_18G102800 [Glycine max] Length = 471 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEK+CPTLA+G KVVVNFSGRGDKDVQTAIK+L+L Sbjct: 432 HALAYLEKVCPTLANGAKVVVNFSGRGDKDVQTAIKYLKL 471 >ref|XP_009342584.1| PREDICTED: tryptophan synthase beta chain 1-like [Pyrus x bretschneideri] Length = 472 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTL DG KVV+N SGRGDKDVQTAIKHL+L Sbjct: 433 HALAYLEKLCPTLPDGAKVVLNCSGRGDKDVQTAIKHLKL 472 >ref|XP_009358128.1| PREDICTED: tryptophan synthase beta chain 1 [Pyrus x bretschneideri] Length = 472 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTL DG KVV+N SGRGDKDVQTAIKHL+L Sbjct: 433 HALAYLEKLCPTLPDGAKVVLNCSGRGDKDVQTAIKHLKL 472 >ref|XP_008454527.1| PREDICTED: tryptophan synthase beta chain 1 [Cucumis melo] Length = 472 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTL DGTKVV+N SGRGDKDVQTAIK+LQ+ Sbjct: 433 HALAYLEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKYLQV 472 >ref|XP_008366477.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Malus domestica] Length = 290 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTL DG KVV+N SGRGDKDVQTAIKHL+L Sbjct: 251 HALAYLEKLCPTLPDGAKVVLNCSGRGDKDVQTAIKHLKL 290 >ref|XP_004142558.1| PREDICTED: tryptophan synthase beta chain 1 [Cucumis sativus] gi|700211598|gb|KGN66694.1| hypothetical protein Csa_1G660140 [Cucumis sativus] Length = 472 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTL DGTKVV+N SGRGDKDVQTAIK+LQ+ Sbjct: 433 HALAYLEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKYLQV 472 >dbj|BAD83779.1| tryptophan synthase beta subunit [Polygonum tinctorium] Length = 474 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTLADGT+VV+N SGRGDKDV TAIKHL++ Sbjct: 435 HALAYLEKLCPTLADGTRVVLNCSGRGDKDVHTAIKHLKM 474 >ref|XP_012841737.1| PREDICTED: tryptophan synthase beta chain 1-like [Erythranthe guttatus] gi|604327951|gb|EYU33619.1| hypothetical protein MIMGU_mgv1a005842mg [Erythranthe guttata] Length = 468 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTLADGTKVV+N SGRGDKDV TAIK+L+L Sbjct: 429 HALAYLEKLCPTLADGTKVVLNCSGRGDKDVHTAIKYLKL 468 >ref|XP_002869581.1| tryptophan synthase beta-subunit [Arabidopsis lyrata subsp. lyrata] gi|297315417|gb|EFH45840.1| tryptophan synthase beta-subunit [Arabidopsis lyrata subsp. lyrata] Length = 471 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/40 (82%), Positives = 40/40 (100%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALA+LEKLCPTL+DGT+VV+NFSGRGDKDVQTAIK+L++ Sbjct: 432 HALAHLEKLCPTLSDGTRVVLNFSGRGDKDVQTAIKYLEV 471 >ref|XP_010539287.1| PREDICTED: tryptophan synthase beta chain 1, chloroplastic [Tarenaya hassleriana] Length = 472 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCP L +GTKVVVNFSGRGDKDVQTAIK LQ+ Sbjct: 433 HALAYLEKLCPNLPNGTKVVVNFSGRGDKDVQTAIKFLQV 472 >ref|XP_010482888.1| PREDICTED: tryptophan synthase beta chain 1, chloroplastic-like [Camelina sativa] Length = 475 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTLADGT+VV+NFSGRGDKDVQT K+L++ Sbjct: 436 HALAYLEKLCPTLADGTRVVLNFSGRGDKDVQTVAKYLEV 475 >ref|XP_010443059.1| PREDICTED: tryptophan synthase beta chain 1, chloroplastic-like [Camelina sativa] Length = 474 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTLADGT+VV+NFSGRGDKDVQT K+L++ Sbjct: 435 HALAYLEKLCPTLADGTRVVLNFSGRGDKDVQTVAKYLEV 474 >ref|XP_010448660.1| PREDICTED: tryptophan synthase beta chain 1, chloroplastic [Camelina sativa] Length = 475 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -3 Query: 321 HALAYLEKLCPTLADGTKVVVNFSGRGDKDVQTAIKHLQL 202 HALAYLEKLCPTLADGT+VV+NFSGRGDKDVQT K+L++ Sbjct: 436 HALAYLEKLCPTLADGTRVVLNFSGRGDKDVQTVAKYLEV 475