BLASTX nr result
ID: Zanthoxylum22_contig00012826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00012826 (308 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006439621.1| hypothetical protein CICLE_v10022028mg [Citr... 63 1e-07 ref|XP_006476630.1| PREDICTED: pectinesterase 3-like [Citrus sin... 60 8e-07 >ref|XP_006439621.1| hypothetical protein CICLE_v10022028mg [Citrus clementina] gi|557541883|gb|ESR52861.1| hypothetical protein CICLE_v10022028mg [Citrus clementina] Length = 233 Score = 62.8 bits (151), Expect = 1e-07 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 6/80 (7%) Frame = -1 Query: 224 MDAVNVMKGYDKVNHHE----INSLPSQQHKRLKAAATISXXXXXXXXXXXXXXXLIHE- 60 MDA+NVMKGYDKV+HH+ I+SL + H+RLK A TIS LI E Sbjct: 1 MDAINVMKGYDKVDHHQHRAGIHSL--RTHQRLKIAVTISAIVLLTLIIGLMLAVLIRES 58 Query: 59 -RRQHQELDAGESIKTVCSV 3 + Q+LDA +SIKTVCSV Sbjct: 59 NTEEQQQLDAAKSIKTVCSV 78 >ref|XP_006476630.1| PREDICTED: pectinesterase 3-like [Citrus sinensis] gi|641857348|gb|KDO76093.1| hypothetical protein CISIN_1g026791mg [Citrus sinensis] Length = 233 Score = 59.7 bits (143), Expect = 8e-07 Identities = 40/80 (50%), Positives = 47/80 (58%), Gaps = 6/80 (7%) Frame = -1 Query: 224 MDAVNVMKGYDKVNHHE----INSLPSQQHKRLKAAATISXXXXXXXXXXXXXXXLIHE- 60 MDA+NVMKGYDKV+H + I+SL + H+RLK A TIS LI E Sbjct: 1 MDAINVMKGYDKVDHLQNRAGIHSL--RTHQRLKTAVTISAIVLLTLIIGLMLAVLIRES 58 Query: 59 -RRQHQELDAGESIKTVCSV 3 + Q LDA ESIKTVCSV Sbjct: 59 NAEEQQRLDAAESIKTVCSV 78