BLASTX nr result
ID: Zanthoxylum22_contig00010991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00010991 (279 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469163.1| PREDICTED: zinc finger homeobox protein 4-li... 74 6e-11 gb|KDO64688.1| hypothetical protein CISIN_1g0324291mg [Citrus si... 72 2e-10 ref|XP_010105391.1| hypothetical protein L484_001671 [Morus nota... 59 1e-06 >ref|XP_006469163.1| PREDICTED: zinc finger homeobox protein 4-like [Citrus sinensis] Length = 141 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 277 YITGPPGNLYPIDTDVNGTASKTIPPSMPLLVASGILGLLAFW 149 YITGPPGNLYP+D+D NG ASK IP S+PLLVASGILGLLA W Sbjct: 99 YITGPPGNLYPVDSDFNG-ASKKIPSSLPLLVASGILGLLALW 140 >gb|KDO64688.1| hypothetical protein CISIN_1g0324291mg [Citrus sinensis] Length = 141 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 277 YITGPPGNLYPIDTDVNGTASKTIPPSMPLLVASGILGLLAFW 149 YITGPPGNLYP+D+D NG ASK IP S+PLLVASGILG LA W Sbjct: 99 YITGPPGNLYPVDSDFNG-ASKKIPSSLPLLVASGILGFLALW 140 >ref|XP_010105391.1| hypothetical protein L484_001671 [Morus notabilis] gi|587916886|gb|EXC04506.1| hypothetical protein L484_001671 [Morus notabilis] Length = 139 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -3 Query: 277 YITGPPGNLYPIDTDV--NGTASKTIPPSMPLLVASGILGLLAFW 149 YITGPPG LYP+D D NG A+K+ P S+P+LVASG+LG+ AFW Sbjct: 96 YITGPPGELYPVDKDFYYNG-AAKSGPISLPILVASGLLGVFAFW 139