BLASTX nr result
ID: Zanthoxylum22_contig00001118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00001118 (505 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428760.1| hypothetical protein CICLE_v10013303mg [Citr... 67 7e-09 ref|XP_006381443.1| hypothetical protein POPTR_0006s12890g [Popu... 61 3e-07 ref|XP_010107522.1| hypothetical protein L484_024375 [Morus nota... 60 5e-07 gb|KDP29131.1| hypothetical protein JCGZ_16520 [Jatropha curcas] 56 9e-06 >ref|XP_006428760.1| hypothetical protein CICLE_v10013303mg [Citrus clementina] gi|557530817|gb|ESR42000.1| hypothetical protein CICLE_v10013303mg [Citrus clementina] Length = 57 Score = 66.6 bits (161), Expect = 7e-09 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = -2 Query: 417 MVYIVEVSLPLILFIFIVALAFYLLGRSRGRSEATTTTVLPQYYG 283 MVYIVEVSLP ILFI IVALAFYLLGR RGRS+A +PQYYG Sbjct: 1 MVYIVEVSLPFILFILIVALAFYLLGRYRGRSQAAR---MPQYYG 42 >ref|XP_006381443.1| hypothetical protein POPTR_0006s12890g [Populus trichocarpa] gi|550336146|gb|ERP59240.1| hypothetical protein POPTR_0006s12890g [Populus trichocarpa] Length = 77 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -2 Query: 417 MVYIVEVSLPLILFIFIVALAFYLLGRSRGRSEATTTTVLPQYYG 283 M Y+V VSLP+ILFI IVALAFYLLGR+RGRSEA +PQY+G Sbjct: 1 MGYVVIVSLPVILFILIVALAFYLLGRARGRSEAAR---IPQYHG 42 >ref|XP_010107522.1| hypothetical protein L484_024375 [Morus notabilis] gi|587929029|gb|EXC16204.1| hypothetical protein L484_024375 [Morus notabilis] Length = 61 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -2 Query: 417 MVYIVEVSLPLILFIFIVALAFYLLGRSRGRSEATTTTVLPQYYG 283 M YIV +S+P+ILFI IVALAFYLLGR+RGRS+A + +PQYYG Sbjct: 1 MGYIVVLSVPVILFILIVALAFYLLGRARGRSQAES---VPQYYG 42 >gb|KDP29131.1| hypothetical protein JCGZ_16520 [Jatropha curcas] Length = 62 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -2 Query: 417 MVYIVEVSLPLILFIFIVALAFYLLGRSRGRSEATTTTVLPQYYG 283 M Y++ VSLPLILFI IVALA YL+GR+ GR EA LPQYYG Sbjct: 1 MGYVIVVSLPLILFILIVALACYLVGRNLGRREAAR---LPQYYG 42