BLASTX nr result
ID: Wisteria21_contig00039767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00039767 (211 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH46012.1| hypothetical protein GLYMA_08G307100 [Glycine max] 77 7e-12 gb|KHM99647.1| NAC domain-containing protein 42 [Glycine soja] 77 7e-12 ref|NP_001242810.1| uncharacterized protein LOC100810472 [Glycin... 77 7e-12 gb|KHN45185.1| NAC domain-containing protein 42 [Glycine soja] 74 3e-11 ref|XP_003551931.1| PREDICTED: transcription factor JUNGBRUNNEN ... 74 3e-11 ref|XP_007146230.1| hypothetical protein PHAVU_006G023100g [Phas... 60 5e-07 ref|XP_014492831.1| PREDICTED: transcription factor JUNGBRUNNEN ... 59 1e-06 gb|KOM51848.1| hypothetical protein LR48_Vigan09g050700 [Vigna a... 59 1e-06 >gb|KRH46012.1| hypothetical protein GLYMA_08G307100 [Glycine max] Length = 304 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -3 Query: 128 YLICKDSLVMQQIERKPVIAQVDEKKHFFLGHFGPVPHH-QAP 3 YLIC+D +VMQQIERKPVI QVDEKKH FLG FGP+PHH QAP Sbjct: 209 YLICRDPMVMQQIERKPVIGQVDEKKHMFLGQFGPLPHHLQAP 251 >gb|KHM99647.1| NAC domain-containing protein 42 [Glycine soja] Length = 304 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -3 Query: 128 YLICKDSLVMQQIERKPVIAQVDEKKHFFLGHFGPVPHH-QAP 3 YLIC+D +VMQQIERKPVI QVDEKKH FLG FGP+PHH QAP Sbjct: 209 YLICRDPMVMQQIERKPVIGQVDEKKHMFLGQFGPLPHHLQAP 251 >ref|NP_001242810.1| uncharacterized protein LOC100810472 [Glycine max] gi|255635676|gb|ACU18187.1| unknown [Glycine max] Length = 304 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -3 Query: 128 YLICKDSLVMQQIERKPVIAQVDEKKHFFLGHFGPVPHH-QAP 3 YLIC+D +VMQQIERKPVI QVDEKKH FLG FGP+PHH QAP Sbjct: 209 YLICRDPMVMQQIERKPVIGQVDEKKHMFLGQFGPLPHHFQAP 251 >gb|KHN45185.1| NAC domain-containing protein 42 [Glycine soja] Length = 304 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -3 Query: 134 KQYLICKDSLVMQQIERKPVIAQVDEKKHFFLGHFGPVPHHQAP 3 K YLIC+D ++MQQIERKPVI QVDEKKH FLG FGP+ H QAP Sbjct: 208 KPYLICRDPMMMQQIERKPVIGQVDEKKHLFLGQFGPLSHLQAP 251 >ref|XP_003551931.1| PREDICTED: transcription factor JUNGBRUNNEN 1 [Glycine max] gi|947049443|gb|KRG98971.1| hypothetical protein GLYMA_18G110700 [Glycine max] Length = 304 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -3 Query: 134 KQYLICKDSLVMQQIERKPVIAQVDEKKHFFLGHFGPVPHHQAP 3 K YLIC+D ++MQQIERKPVI QVDEKKH FLG FGP+ H QAP Sbjct: 208 KPYLICRDPMMMQQIERKPVIGQVDEKKHLFLGQFGPLSHLQAP 251 >ref|XP_007146230.1| hypothetical protein PHAVU_006G023100g [Phaseolus vulgaris] gi|561019453|gb|ESW18224.1| hypothetical protein PHAVU_006G023100g [Phaseolus vulgaris] Length = 306 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -3 Query: 134 KQYLICKDSLVMQQIERKPVIAQVDEKKHFFLGHFGPVPHHQAP 3 K YLIC+D+ +MQQ+ KPV QVDEKKH FLG FG +PH Q P Sbjct: 213 KPYLICRDTEMMQQL--KPVFGQVDEKKHLFLGQFGQLPHLQTP 254 >ref|XP_014492831.1| PREDICTED: transcription factor JUNGBRUNNEN 1-like [Vigna radiata var. radiata] Length = 305 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -3 Query: 134 KQYLICKDSLVMQQIERKPVIAQVDEKKHFFLGHFGPVPHHQAP 3 K YLIC+D +MQQ+ KPV QVDEKKH FLG FG +PH Q P Sbjct: 213 KPYLICRDPEMMQQL--KPVFGQVDEKKHLFLGQFGQLPHLQPP 254 >gb|KOM51848.1| hypothetical protein LR48_Vigan09g050700 [Vigna angularis] Length = 305 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -3 Query: 134 KQYLICKDSLVMQQIERKPVIAQVDEKKHFFLGHFGPVPHHQAP 3 K YLIC+D +MQQ+ KPV QVDEKKH FLG FG +PH Q P Sbjct: 213 KPYLICRDPDMMQQL--KPVFGQVDEKKHLFLGQFGQLPHLQPP 254