BLASTX nr result
ID: Wisteria21_contig00039156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00039156 (219 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006606038.1| PREDICTED: putative F-box protein At3g58860-... 113 5e-23 >ref|XP_006606038.1| PREDICTED: putative F-box protein At3g58860-like isoform X1 [Glycine max] gi|947041519|gb|KRG91243.1| hypothetical protein GLYMA_20G142600 [Glycine max] Length = 468 Score = 113 bits (283), Expect = 5e-23 Identities = 52/72 (72%), Positives = 62/72 (86%) Frame = -3 Query: 217 CVKELILTPYAFEVLTYSKELYACLPVLYQVTCLGFPLLGTAINFGCGTMANFLQKLPCL 38 C KEL+LTPYAFEVLTYS+ L AC+PVLY+VT LGF GTAINFGC +A FL+KLPCL Sbjct: 307 CAKELLLTPYAFEVLTYSEYLCACMPVLYKVTYLGFLSPGTAINFGCRALAKFLEKLPCL 366 Query: 37 EVVIFQSGICLS 2 E+++FQSG+CLS Sbjct: 367 ELLVFQSGVCLS 378