BLASTX nr result
ID: Wisteria21_contig00039143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00039143 (268 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597123.1| hypothetical protein MTR_2g092920 [Medicago ... 72 2e-10 >ref|XP_003597123.1| hypothetical protein MTR_2g092920 [Medicago truncatula] gi|355486171|gb|AES67374.1| hypothetical protein MTR_2g092920 [Medicago truncatula] Length = 129 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +2 Query: 5 KLRLTEEEEADLVIKFAHNQQYEKFF*EFQGP*RMSFVRKIMRM 136 KLRLT+E+E DL IKF+HNQQYEKFF EF+G RM+FVRKIMRM Sbjct: 86 KLRLTDEDEIDLAIKFSHNQQYEKFFWEFEGSQRMTFVRKIMRM 129