BLASTX nr result
ID: Wisteria21_contig00039054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00039054 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004512045.1| PREDICTED: nucleolar protein 6-like [Cicer a... 63 1e-07 ref|XP_004512044.1| PREDICTED: nucleolar protein 6-like [Cicer a... 63 1e-07 ref|XP_003612000.1| nucleolar RNA-associated protein, putative [... 62 2e-07 gb|KHN41974.1| Nucleolar protein 6 [Glycine soja] 57 7e-06 ref|XP_006590688.1| PREDICTED: nucleolar protein 6-like isoform ... 57 7e-06 ref|XP_003537588.1| PREDICTED: nucleolar protein 6-like isoform ... 57 7e-06 >ref|XP_004512045.1| PREDICTED: nucleolar protein 6-like [Cicer arietinum] Length = 1052 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 314 EGQDPYKVLKAAGEVGKGFVRSIYFLKPPRLTN 216 EG DP KVLKA GEVGKGFVRSIYFLKPPR+TN Sbjct: 1020 EGYDPRKVLKAVGEVGKGFVRSIYFLKPPRVTN 1052 >ref|XP_004512044.1| PREDICTED: nucleolar protein 6-like [Cicer arietinum] Length = 1049 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 314 EGQDPYKVLKAAGEVGKGFVRSIYFLKPPRLTN 216 EG DP KVLKA GEVGKGFVRSIYFLKPPR+TN Sbjct: 1017 EGYDPRKVLKAVGEVGKGFVRSIYFLKPPRVTN 1049 >ref|XP_003612000.1| nucleolar RNA-associated protein, putative [Medicago truncatula] gi|355513335|gb|AES94958.1| nucleolar RNA-associated protein, putative [Medicago truncatula] Length = 1048 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -2 Query: 314 EGQDPYKVLKAAGEVGKGFVRSIYFLKPPRLTN 216 EG DP KVLKA GEVGKGFVRSIYFLKPPRL N Sbjct: 1016 EGYDPRKVLKAVGEVGKGFVRSIYFLKPPRLAN 1048 >gb|KHN41974.1| Nucleolar protein 6 [Glycine soja] Length = 961 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 305 DPYKVLKAAGEVGKGFVRSIYFLKPPRLTN 216 DP KVLKA GEVGKGFVRSIYFLKPP+L N Sbjct: 932 DPCKVLKAVGEVGKGFVRSIYFLKPPKLMN 961 >ref|XP_006590688.1| PREDICTED: nucleolar protein 6-like isoform X2 [Glycine max] gi|947079889|gb|KRH28678.1| hypothetical protein GLYMA_11G068600 [Glycine max] Length = 1049 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 305 DPYKVLKAAGEVGKGFVRSIYFLKPPRLTN 216 DP KVLKA GEVGKGFVRSIYFLKPP+L N Sbjct: 1020 DPCKVLKAVGEVGKGFVRSIYFLKPPKLMN 1049 >ref|XP_003537588.1| PREDICTED: nucleolar protein 6-like isoform X1 [Glycine max] gi|947079890|gb|KRH28679.1| hypothetical protein GLYMA_11G068600 [Glycine max] Length = 1050 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 305 DPYKVLKAAGEVGKGFVRSIYFLKPPRLTN 216 DP KVLKA GEVGKGFVRSIYFLKPP+L N Sbjct: 1021 DPCKVLKAVGEVGKGFVRSIYFLKPPKLMN 1050