BLASTX nr result
ID: Wisteria21_contig00037679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037679 (276 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM30968.1| hypothetical protein LR48_Vigan01g052300 [Vigna a... 152 9e-35 ref|XP_007159402.1| hypothetical protein PHAVU_002G235300g [Phas... 152 9e-35 ref|XP_014510182.1| PREDICTED: pentatricopeptide repeat-containi... 152 1e-34 emb|CBI21005.3| unnamed protein product [Vitis vinifera] 150 4e-34 ref|XP_002282464.1| PREDICTED: pentatricopeptide repeat-containi... 150 4e-34 ref|XP_011660234.1| PREDICTED: pentatricopeptide repeat-containi... 148 1e-33 ref|XP_008443720.1| PREDICTED: pentatricopeptide repeat-containi... 148 1e-33 ref|XP_003524191.2| PREDICTED: pentatricopeptide repeat-containi... 147 4e-33 ref|XP_012567922.1| PREDICTED: pentatricopeptide repeat-containi... 146 5e-33 ref|XP_004488760.1| PREDICTED: pentatricopeptide repeat-containi... 146 5e-33 emb|CAN80315.1| hypothetical protein VITISV_020760 [Vitis vinifera] 146 7e-33 ref|XP_003532746.1| PREDICTED: pentatricopeptide repeat-containi... 144 2e-32 ref|XP_011627731.1| PREDICTED: pentatricopeptide repeat-containi... 142 8e-32 ref|XP_008218777.1| PREDICTED: pentatricopeptide repeat-containi... 142 8e-32 ref|XP_007225613.1| hypothetical protein PRUPE_ppa003215mg [Prun... 142 8e-32 ref|XP_006483319.1| PREDICTED: pentatricopeptide repeat-containi... 142 1e-31 ref|XP_006450490.1| hypothetical protein CICLE_v10007521mg [Citr... 142 1e-31 ref|XP_012082955.1| PREDICTED: pentatricopeptide repeat-containi... 142 1e-31 ref|XP_010102722.1| hypothetical protein L484_015521 [Morus nota... 141 2e-31 ref|XP_009347182.1| PREDICTED: pentatricopeptide repeat-containi... 140 4e-31 >gb|KOM30968.1| hypothetical protein LR48_Vigan01g052300 [Vigna angularis] Length = 681 Score = 152 bits (384), Expect = 9e-35 Identities = 73/76 (96%), Positives = 73/76 (96%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLAVAYGLLSSS RSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK Sbjct: 606 KEEALLAHSERLAVAYGLLSSSARSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 665 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 666 RFHHFKDGLCSCRDYW 681 >ref|XP_007159402.1| hypothetical protein PHAVU_002G235300g [Phaseolus vulgaris] gi|561032817|gb|ESW31396.1| hypothetical protein PHAVU_002G235300g [Phaseolus vulgaris] Length = 679 Score = 152 bits (384), Expect = 9e-35 Identities = 73/76 (96%), Positives = 73/76 (96%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLAVAYGLLSSS RSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK Sbjct: 604 KEEALLAHSERLAVAYGLLSSSARSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 663 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 664 RFHHFKDGLCSCRDYW 679 >ref|XP_014510182.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Vigna radiata var. radiata] Length = 690 Score = 152 bits (383), Expect = 1e-34 Identities = 72/76 (94%), Positives = 73/76 (96%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLAVAYGLLSSS RSPIRVIKNLRVCGDCHTALKIISKLVGREL+IRDAK Sbjct: 615 KEEALLAHSERLAVAYGLLSSSARSPIRVIKNLRVCGDCHTALKIISKLVGRELVIRDAK 674 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 675 RFHHFKDGLCSCRDYW 690 >emb|CBI21005.3| unnamed protein product [Vitis vinifera] Length = 676 Score = 150 bits (379), Expect = 4e-34 Identities = 72/76 (94%), Positives = 72/76 (94%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLAVAYGLLSS RSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK Sbjct: 601 KEEALLAHSERLAVAYGLLSSPARSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 660 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 661 RFHHFKDGLCSCRDYW 676 >ref|XP_002282464.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial [Vitis vinifera] Length = 807 Score = 150 bits (379), Expect = 4e-34 Identities = 72/76 (94%), Positives = 72/76 (94%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLAVAYGLLSS RSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK Sbjct: 732 KEEALLAHSERLAVAYGLLSSPARSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 791 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 792 RFHHFKDGLCSCRDYW 807 >ref|XP_011660234.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial [Cucumis sativus] gi|700211593|gb|KGN66689.1| hypothetical protein Csa_1G659600 [Cucumis sativus] Length = 731 Score = 148 bits (374), Expect = 1e-33 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 K +ALLGH ERLAVAYGL+SSS RSPIRVIKNLRVCGDCH+ALKIISK+VGRELIIRDAK Sbjct: 656 KNDALLGHSERLAVAYGLISSSARSPIRVIKNLRVCGDCHSALKIISKIVGRELIIRDAK 715 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 716 RFHHFKDGLCSCRDYW 731 >ref|XP_008443720.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Cucumis melo] gi|659086009|ref|XP_008443721.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Cucumis melo] gi|659086011|ref|XP_008443722.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Cucumis melo] gi|659086013|ref|XP_008443723.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Cucumis melo] gi|659086020|ref|XP_008443724.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Cucumis melo] Length = 748 Score = 148 bits (374), Expect = 1e-33 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 K +ALLGH ERLAVAYGL+SSS RSPIRVIKNLRVCGDCH+ALKIISK+VGRELIIRDAK Sbjct: 673 KNDALLGHSERLAVAYGLISSSARSPIRVIKNLRVCGDCHSALKIISKIVGRELIIRDAK 732 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 733 RFHHFKDGLCSCRDYW 748 >ref|XP_003524191.2| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Glycine max] gi|947110577|gb|KRH58903.1| hypothetical protein GLYMA_05G155200 [Glycine max] Length = 665 Score = 147 bits (370), Expect = 4e-33 Identities = 69/76 (90%), Positives = 72/76 (94%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLAVAYGLL+S R+P+RVIKNLRVCGDCHTALKIISKLVGRELIIRDAK Sbjct: 590 KEEALLAHSERLAVAYGLLNSPARAPMRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 649 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 650 RFHHFKDGLCSCRDYW 665 >ref|XP_012567922.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X2 [Cicer arietinum] gi|828292223|ref|XP_012567923.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X3 [Cicer arietinum] Length = 676 Score = 146 bits (369), Expect = 5e-33 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KE+ALL H ERLAVAYGLL+SS RSPIRVIKNLRVCGDCHTALKIIS+LVGRELIIRDAK Sbjct: 601 KEDALLAHSERLAVAYGLLNSSARSPIRVIKNLRVCGDCHTALKIISELVGRELIIRDAK 660 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFK+GLCSCRDYW Sbjct: 661 RFHHFKNGLCSCRDYW 676 >ref|XP_004488760.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X1 [Cicer arietinum] gi|828292217|ref|XP_012567921.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X1 [Cicer arietinum] Length = 697 Score = 146 bits (369), Expect = 5e-33 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KE+ALL H ERLAVAYGLL+SS RSPIRVIKNLRVCGDCHTALKIIS+LVGRELIIRDAK Sbjct: 622 KEDALLAHSERLAVAYGLLNSSARSPIRVIKNLRVCGDCHTALKIISELVGRELIIRDAK 681 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFK+GLCSCRDYW Sbjct: 682 RFHHFKNGLCSCRDYW 697 >emb|CAN80315.1| hypothetical protein VITISV_020760 [Vitis vinifera] Length = 1148 Score = 146 bits (368), Expect = 7e-33 Identities = 71/75 (94%), Positives = 71/75 (94%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLAVAYGLLSS RSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK Sbjct: 732 KEEALLAHSERLAVAYGLLSSPARSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 791 Query: 95 RFHHFKDGLCSCRDY 51 RFHHFKDGLCSCRDY Sbjct: 792 RFHHFKDGLCSCRDY 806 >ref|XP_003532746.1| PREDICTED: pentatricopeptide repeat-containing protein At2g25580-like isoform X1 [Glycine max] gi|947094227|gb|KRH42812.1| hypothetical protein GLYMA_08G113100 [Glycine max] gi|947094228|gb|KRH42813.1| hypothetical protein GLYMA_08G113100 [Glycine max] Length = 664 Score = 144 bits (364), Expect = 2e-32 Identities = 67/76 (88%), Positives = 71/76 (93%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLA+AYGLL+S R+P+RVIKNLRVCGDCHTALKIISKLVGRELIIRDAK Sbjct: 589 KEEALLAHSERLAIAYGLLNSPARAPMRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 648 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHF DGLCSCRDYW Sbjct: 649 RFHHFNDGLCSCRDYW 664 >ref|XP_011627731.1| PREDICTED: pentatricopeptide repeat-containing protein At2g25580-like [Amborella trichopoda] Length = 506 Score = 142 bits (359), Expect = 8e-32 Identities = 65/76 (85%), Positives = 71/76 (93%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLA+AYGLLSS SPIR+IKNLR+CGDCH+ALKI+SKLVGRELI+RDAK Sbjct: 431 KEEALLYHSERLAIAYGLLSSPACSPIRIIKNLRICGDCHSALKIVSKLVGRELIVRDAK 490 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 491 RFHHFKDGLCSCRDYW 506 >ref|XP_008218777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial [Prunus mume] Length = 711 Score = 142 bits (359), Expect = 8e-32 Identities = 66/76 (86%), Positives = 70/76 (92%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KE+ALL H ERLAVAY LLSS RSP+RVIKNLRVCGDCH ALKIISK+VGRELI+RDAK Sbjct: 636 KEDALLAHSERLAVAYALLSSPARSPVRVIKNLRVCGDCHNALKIISKIVGRELIMRDAK 695 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 696 RFHHFKDGLCSCRDYW 711 >ref|XP_007225613.1| hypothetical protein PRUPE_ppa003215mg [Prunus persica] gi|462422549|gb|EMJ26812.1| hypothetical protein PRUPE_ppa003215mg [Prunus persica] Length = 592 Score = 142 bits (359), Expect = 8e-32 Identities = 66/76 (86%), Positives = 70/76 (92%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KE+ALL H ERLAVAY LLSS RSP+RVIKNLRVCGDCH ALKIISK+VGRELI+RDAK Sbjct: 517 KEDALLAHSERLAVAYALLSSPARSPVRVIKNLRVCGDCHNALKIISKIVGRELIMRDAK 576 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 577 RFHHFKDGLCSCRDYW 592 >ref|XP_006483319.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Citrus sinensis] gi|641842771|gb|KDO61674.1| hypothetical protein CISIN_1g004114mg [Citrus sinensis] Length = 773 Score = 142 bits (358), Expect = 1e-31 Identities = 65/76 (85%), Positives = 72/76 (94%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLAV++GLLSS R+PIR++KNLRVCGDCH+ALKIISK+VGRELIIRDAK Sbjct: 698 KEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAK 757 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 758 RFHHFKDGLCSCRDYW 773 >ref|XP_006450490.1| hypothetical protein CICLE_v10007521mg [Citrus clementina] gi|557553716|gb|ESR63730.1| hypothetical protein CICLE_v10007521mg [Citrus clementina] Length = 773 Score = 142 bits (358), Expect = 1e-31 Identities = 65/76 (85%), Positives = 72/76 (94%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KEEALL H ERLAV++GLLSS R+PIR++KNLRVCGDCH+ALKIISK+VGRELIIRDAK Sbjct: 698 KEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAK 757 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 758 RFHHFKDGLCSCRDYW 773 >ref|XP_012082955.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Jatropha curcas] gi|643716675|gb|KDP28301.1| hypothetical protein JCGZ_14072 [Jatropha curcas] Length = 703 Score = 142 bits (357), Expect = 1e-31 Identities = 65/76 (85%), Positives = 70/76 (92%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KE+ALL H ERLA AYGLLSS RSPIRVIKNLRVCGDCH A+KIISK+VGRELI+RDAK Sbjct: 628 KEDALLAHSERLAAAYGLLSSPARSPIRVIKNLRVCGDCHNAMKIISKIVGRELIMRDAK 687 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDG+CSCRDYW Sbjct: 688 RFHHFKDGVCSCRDYW 703 >ref|XP_010102722.1| hypothetical protein L484_015521 [Morus notabilis] gi|587905856|gb|EXB93974.1| hypothetical protein L484_015521 [Morus notabilis] Length = 719 Score = 141 bits (356), Expect = 2e-31 Identities = 65/76 (85%), Positives = 71/76 (93%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KE+ALL H ERLA+A GLLS+S RSPIRVIKNLRVCGDCH ALKI+SK+VGRELI+RDAK Sbjct: 644 KEDALLAHSERLALAQGLLSTSARSPIRVIKNLRVCGDCHNALKIVSKIVGRELIMRDAK 703 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 704 RFHHFKDGLCSCRDYW 719 >ref|XP_009347182.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Pyrus x bretschneideri] gi|694440764|ref|XP_009347183.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Pyrus x bretschneideri] gi|694440767|ref|XP_009347184.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Pyrus x bretschneideri] gi|694440769|ref|XP_009347185.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Pyrus x bretschneideri] Length = 720 Score = 140 bits (353), Expect = 4e-31 Identities = 65/76 (85%), Positives = 71/76 (93%) Frame = -2 Query: 275 KEEALLGHRERLAVAYGLLSSSVRSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAK 96 KE+ALL H ERLA+A+GL+SSS RS IRVIKNLRVCGDCH ALKIISK+VGRELI+RDAK Sbjct: 645 KEDALLAHSERLALAHGLISSSARSTIRVIKNLRVCGDCHNALKIISKIVGRELIMRDAK 704 Query: 95 RFHHFKDGLCSCRDYW 48 RFHHFKDGLCSCRDYW Sbjct: 705 RFHHFKDGLCSCRDYW 720