BLASTX nr result
ID: Wisteria21_contig00037639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037639 (331 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013461772.1| galactose oxidase [Medicago truncatula] gi|6... 59 1e-06 >ref|XP_013461772.1| galactose oxidase [Medicago truncatula] gi|657395533|gb|KEH35807.1| galactose oxidase [Medicago truncatula] Length = 378 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 330 LEHRSYCNGPHGSQVTMYTESLLSLPGDSEQA 235 LEHRSYCN P G QV MYTESLLSLPGD+EQA Sbjct: 347 LEHRSYCNDPCGCQVVMYTESLLSLPGDNEQA 378