BLASTX nr result
ID: Wisteria21_contig00037530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037530 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM51051.1| hypothetical protein LR48_Vigan08g187800 [Vigna a... 59 1e-06 ref|XP_007131656.1| hypothetical protein PHAVU_011G031000g [Phas... 57 4e-06 >gb|KOM51051.1| hypothetical protein LR48_Vigan08g187800 [Vigna angularis] Length = 852 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = +2 Query: 335 EYTFRFENGISPLDFVDNN-DSGVQSYQQFERLE 433 EYTFRFENG++PLDFVDNN DSG+Q Y++FERLE Sbjct: 39 EYTFRFENGMNPLDFVDNNDDSGLQPYERFERLE 72 >ref|XP_007131656.1| hypothetical protein PHAVU_011G031000g [Phaseolus vulgaris] gi|561004656|gb|ESW03650.1| hypothetical protein PHAVU_011G031000g [Phaseolus vulgaris] Length = 917 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +2 Query: 335 EYTFRFENGISPLDFVDNN-DSGVQSYQQFERLE 433 EYTFRF+NG+ PLDF+DNN DSG+Q Y++FERLE Sbjct: 42 EYTFRFQNGMDPLDFIDNNDDSGLQPYERFERLE 75