BLASTX nr result
ID: Wisteria21_contig00037407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037407 (206 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007146067.1| hypothetical protein PHAVU_006G010000g [Phas... 58 3e-06 >ref|XP_007146067.1| hypothetical protein PHAVU_006G010000g [Phaseolus vulgaris] gi|561019290|gb|ESW18061.1| hypothetical protein PHAVU_006G010000g [Phaseolus vulgaris] Length = 979 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 2/68 (2%) Frame = +3 Query: 3 LPPSLKVLSAINCTSLDRDSTQRLVL--MIENWVQRMSYLLEYQNDFFYASFILPGDQIP 176 LPPSL+ LSA NCTSLD TQRLVL M+++ R+ YL ++ + ++LPG+ + Sbjct: 776 LPPSLEKLSASNCTSLDSYMTQRLVLQHMLQS---RIPYLRKHYLRCYDEEYLLPGEHVS 832 Query: 177 SKLGFHTT 200 + GFHTT Sbjct: 833 DECGFHTT 840